KEGG   Rattus norvegicus (rat): 64573Help
Entry
64573             CDS       T01003                                 

Gene name
Trpc2, Trrp2
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 2, pseudogene
  KO
K04965  transient receptor potential cation channel subfamily C member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    64573 (Trpc2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   64573 (Trpc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 gp37_C Ank
Motif
Other DBs
NCBI-GeneID: 64573
NCBI-ProteinID: XP_008758034
RGD: 628819
Ensembl: ENSRNOG00000020188
Position
1q32
AA seq 902 aa AA seqDB search
LQKVILGTQECCPLSFTQPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESGSDPS
GAGPGGPLRNVEESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTN
QPAVVRRLLARLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQL
LMDQGHTIARPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAA
FQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEP
EAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKL
FVAFLIFLTMPFLCIGYWLAPKSRLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQ
LSTFKGRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLASF
ALRLLLAGLAYMHCRDASDSSTCRYFTTAERSEWRTEDPQFLAEVLFAVTSMLSFTRLAY
ILPAHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQETEKLGNFNETF
QFLFWTMFGMEEHSVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIED
DADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAAFYLLRRIFRFICCGSSCCKAKKS
DYPPIPTFTNPGARAGPGEGEHVSYRLRVIKALVQRYIETARREFEETRRKDLGNRLTEL
TKTVSRLQSEVASVQKTVAAGGALRPPDGASILSRYITRVRNSFQNLGPPAPDTPAELTM
PGIVETEVSLEDSLDATGEAGTPASGESSSSSSAHVLVHREQEAEGAGDLPLGEDLETKG
ES
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
ttacagaaggtaatcttgggaactcaagagtgctgtcctctctccttcacccaaccacag
cccaactggactgagattgtgaacaaaaagctcaaattccccccaacactgctgcgtgct
atccaggagggccagctgggtctcgtgcagcagctgctggaatcaggctccgatccctcg
ggtgctgggccaggtggtcctctgcggaatgtggaagagtctgaggaccgctcctggagg
gaagcccttaatctggccatccgcctgggccacgaggtcatcactgatgttctgctggcc
aatgtcaagtttgacttccggcagatccacgaagccctgctagtggctgtggacacaaac
cagccagcggtagtgcgtcgtctgttagctcggctggaacgggagaaaggtcgaaaagta
gacaccaagtctttctctttagccttctttgactcatcaatcgatggctcccgctttgcc
cctggtgttactccactcacactggcctgccagaaggacctgtatgagattgcccagctg
cttatggaccagggccacactattgctcggccccacccagtttcctgtgcctgcctcgag
tgcagcaatgcgcgccgatatgacctgctgaagttctcactatcccgaatcaacacctac
cggggcattgctagcagggctcacctctcgctggccagtgaggatgccatgctggcggcc
tttcagctcagccgggagctcaggcgccttgcacggaaggagcctgagtttaagcctcag
tacattgccctggagtctctctgccaggactatggctttgagttgctgggcatgtgccgg
aatcagagtgaggtcactgcagtgctcaatgacctgggcgaggatagtgagactgagcct
gaggctgagggcctgggccaggcctttgaggagggcatccctaacctggcaagactgcgg
ttggctgtcaactacaaccagaaacagtttgtagcacaccccatctgccagcaagtgctg
tcttccatttggtgtgggaacctggctggctggcgcgggagcaccaccatctggaagctc
tttgtggccttcctcatcttcctcaccatgcccttcctctgcattggctactggctggcg
cccaagtcccggctgggccgcctgctgaagatcccagtgttgaagttcctgctccattct
gcctcctatctgtggttcctgatcttcttgctgggagagtctctggtcatggagactcag
ctgagcaccttcaaaggccgcagtcagagtgtctgggagacttctctgcatatgatttgg
gtcacaggctttctgtggtttgagtgtaaggaggtgtggatcgagggcttgcgaagctac
ctcctggactggtggaacttcctggacgtggtcatcctgtctctgtacctggcatccttt
gcactgcgcctcctcctggctggacttgcctacatgcactgccgggacgcctcagacagc
agcacctgccgatacttcaccacagctgagcgaagtgagtggcgcacagaggacccccag
ttcctggccgaggtgctctttgctgtcacgagcatgctcagtttcacccgattggcgtat
attctgccagctcacgaatcattgggcactctgcagatctccattggcaagatgattgac
gacatgatccggttcatgttcatcctcatgatcatcctgactgccttcctctgcggcctc
aacaacatctatgtgccctaccaggagacggagaagctgggcaatttcaacgaaacgttc
cagttcctcttctggaccatgtttggcatggaagagcactctgtggtggacatgccccag
ttcctggtgcctgagttcgtgggccgggccatgtacggcatctttaccatcgtcatggtg
attgtgctactcaacatgctcatcgccatgatcaccaactccttccagaagatcgaggac
gatgctgatgtagagtggaagtttgctcgctccaagctctacctgtcctacttccgagag
ggtctgacgctgcctgtgccttttaacatcctgccatccccaaaggctgccttctacctt
ctcaggaggattttccggttcatttgctgtggctcctcctgttgcaaagccaagaagtcg
gactatcccccaatcccgacctttaccaaccctggggcaagggcggggcctggggaagga
gaacatgtgtcctaccgccttcgagtcatcaaggctctggtgcagcgctacatagagact
gcccggcgcgagttcgaggagacccgtcggaaagatctgggcaacagactgacagagctg
accaagactgtgtctcgactgcaaagcgaggtggccagtgtgcagaagactgtggcagcg
ggaggggcgctgcggcctccggatggcgccagcatcctcagtcggtacatcacccgagtg
cgcaacagcttccagaacctgggcccccctgcccctgacacccccgcagagctgacgatg
cctgggattgtggagaccgaagtctccttagaagatagccttgatgctacaggagaggct
gggactccagcttctggagagtccagctcttcctcctcggcccatgtgctggtacacagg
gagcaagaagcagagggggcaggggacttgcccctgggggaagatctggagaccaagggc
gagtcctaa

DBGET integrated database retrieval system