KEGG   Rattus norvegicus (rat): 65134Help
Entry
65134             CDS       T01003                                 

Gene name
Stx5, Stx5a
Definition
(RefSeq) syntaxin 5
  KO
K08490  syntaxin 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    65134 (Stx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65134 (Stx5)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    65134 (Stx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE Syntaxin-5_N Syntaxin UPF0242 Apolipoprotein DUF16 MCPsignal Vac_Fusion DUF5063 SKA1 DUF1664
Motif
Other DBs
NCBI-GeneID: 65134
NCBI-ProteinID: NP_113892
RGD: 68426
Ensembl: ENSRNOG00000018847
UniProt: Q08851
Position
1q43
AA seq 355 aa AA seqDB search
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAINSSSDIAPLPTPVALVPSPPDTMSCRDR
TQEFLSACKSLQSRQNGIQTNKPALHATRQCSEFTLMARRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRNRREQFSRAPVSALPLAPNNLGGGPIVLGGESRAS
RDVAIDMMDPRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcggaaacgctacggatctaagaacacggatcagggtgtctacctgggtctc
tcaaagacacaggttctgtcccctgcaactgctatcaatagcagcagtgacatcgctcct
ttgcccaccccggtggccctggtcccctcccctcccgacactatgtcctgccgggatcgg
acccaggagttcctgtctgcctgcaagtcgctgcagagccgtcagaatggaatccaaaca
aataaaccagctctgcacgctacccggcagtgcagcgagtttaccctcatggccaggcgc
attgggaaagatctcagcaatacatttgccaagctggagaagctaacaatcctggcaaag
cgcaagtccctctttgatgataaagcagtagaaattgaggaactaacatacatcatcaaa
caggacatcaatagcctcaacaaacaaattgctcagcttcaagattttgtgagggccaag
ggcagccagagtggccggcatctgcagacccattccaacaccattgtagtttcattgcag
tcaaaactggcttccatgtccaatgacttcaagtctgttttggaagtgaggactgaaaat
ctgaaacagcagaggaaccgtcgggaacagttctccagggcgccagtgtcggcactgcct
ctggcccccaacaaccttggaggtggtcccatagttctgggaggagagtcccgagcctcc
agggacgtggccatcgacatgatggaccctagaacaagccagcagcttcagctcattgat
gagcaggattcctacatccagagtcgggcagacaccatgcagaacattgagtctacaatt
gttgagctgggctccatttttcaacaattggcacacatggttaaagaacaggaggaaaca
attcagaggattgacgagaatgtgcttggagcccagctggatgttgaggccgcccattca
gagatcctcaagtacttccagtcagtcacctccaatcggtggctcatggtcaaaatcttc
ctcatcctcattgtcttcttcatcatctttgtggtcttccttgcctga

DBGET integrated database retrieval system