KEGG   Rattus norvegicus (rat): 65137
Entry
65137             CDS       T01003                                 
Symbol
Ruvbl1
Name
(RefSeq) ruvB-like 1
  KO
K04499  RuvB-like protein 1 [EC:5.6.2.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    65137 (Ruvbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    65137 (Ruvbl1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:rno03037]
    65137 (Ruvbl1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     65137 (Ruvbl1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     65137 (Ruvbl1)
  Chromatin remodeling factors
   SRCAP complex
    65137 (Ruvbl1)
   INO80 complex
    65137 (Ruvbl1)
   INO80 complex (yeast)
    65137 (Ruvbl1)
   SWR1 complex
    65137 (Ruvbl1)
   ASTRA complex
    65137 (Ruvbl1)
Cilium and associated proteins [BR:rno03037]
 Motile cilia and associated proteins
  Dynein assembly factors
   65137 (Ruvbl1)
SSDB
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N AAA_22 AAA_5 AAA_16 Sigma54_activat bpMoxR Mg_chelatase AAA_25 AAA_19 AAA_18 AAA_28 IstB_IS21 DnaB_C Zeta_toxin TsaE AAA_7 ResIII AAA_33 NACHT Parvo_NS1 PhoH AAA_30 AAA_11 NTPase_1 ATPase DUF2075 RNA_helicase
Other DBs
NCBI-GeneID: 65137
NCBI-ProteinID: NP_671706
RGD: 68373
Ensembl: ENSRNOG00000013195
UniProt: P60123
Position
4:120932486..120967400
AA seq 456 aa
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagattgaggaggtgaagagcaccacgaagacgcaacgcattgcctcccacagccac
gtgaaggggctggggctggatgagagcggcctggccaagcaggcggcttcggggctcgtg
ggccaggagaacgcgagagaggcatgtggtgtcatagtcgaattaatcaaaagcaagaaa
atggctggaagagctgtcttgttggcagggcctcctggaactggcaagacagccttggcc
ctggctattgctcaggaactgggcagtaaagtccctttctgcccgatggtgggtagtgaa
gtatactcaactgagatcaagaagacagaggtgctgatggagaacttccgaagggctatt
gggctgcggataaaggagactaaggaggtttatgaaggggaggtgacagagctcactccc
tgtgagacagagaaccccatgggtgggtatggcaaaactatcagccacgtgatcataggg
ctcaagactgccaaaggaaccaaacagctgaagctggaccccagtatttttgaaagtttg
cagaaagaacgagtagaggctggagatgtgatttacattgaagcaaacagtggagctgtg
aagaggcaaggcaggtgtgacacctatgccacagagtttgaccttgaggctgaagagtat
gtccctttgccaaagggagatgtgcacaagaagaaggaaatcatacaggatgtgaccttg
cacgacttggacgtggccaatgcgcggcctcagggtgggcaagatattctgtctatgatg
ggccagttgatgaagccaaaaaagacagagatcacagataaacttcgaggggagatcaac
aaggtggtgaacaaatacattgaccagggcgttgcagagctggtccctggagtgctcttt
gttgacgaggtccacatgctggatatcgagtgctttacctacctgcaccgagccctggag
tcctccatcgcccccattgtcatctttgcatccaaccgaggcaactgtgtcatcaggggc
accgaggacatcacttctccacacggcatcccgttggacctgctggaccgggtgatgatc
atcaggaccatgctgtatacgccacaggagatgaagcagatcattaagatccgagcccag
acggaaggcatcaacatcagtgaggaggccctaaaccacctcggggagattggcaccaag
accacgctgaggtattcagtgcagctgctgacccctgccaacctgctggccaagatcaac
gggaaggacagcattgagaaggagcacgtggaggagatcagcgagctcttctatgacgcc
aagtcctccgccaagattctggccgaccagcaggacaagtacatgaagtaa

DBGET integrated database retrieval system