KEGG   Rattus norvegicus (rat): 66013Help
Entry
66013             CDS       T01003                                 

Gene name
Arhgef9
Definition
(RefSeq) Cdc42 guanine nucleotide exchange factor 9
  KO
K20686  Rho guanine nucleotide exchange factor 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    66013 (Arhgef9)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    66013 (Arhgef9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 SH3_2 PH SH3_9
Motif
Other DBs
NCBI-GeneID: 66013
NCBI-ProteinID: NP_076447
RGD: 620719
UniProt: Q9QX73
Structure
PDB: 

Position
Xq22
AA seq 493 aa AA seqDB search
MQWIRGGSGMLITGDSIVSAEAVWDHVTMANRGVAFKAGDVIKVLDASNKDWWWGQIDDE
EGWFPASFVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMS
TERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNND
DPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDI
AIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLEN
IDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKD
LIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEK
IRWLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKASKQKGRVGEEENQSLELKRAC
EVLQRLWSPGKKS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggattagaggcggatcgggaatgctgatcactggagattccatcgttagtgct
gaggcagtatgggatcacgtcaccatggccaaccggggagttgcatttaaggctggcgac
gtcatcaaagtcttggatgcttccaacaaggattggtggtggggccagatcgacgatgag
gagggatggtttcctgccagctttgtgaggctctgggtgaaccaggaggatggggtggag
gaagggcccagtgacgtgcagaatgggcacctggaccccaactcagactgcctctgtctg
ggccggccactacagaaccgggaccagatgcgggccaatgtcatcaatgagatcatgagc
acggaacgtcattacatcaagcatctcaaggacatttgcgaggggtacctgaagcagtgc
cgaaagagaagggacatgttcagtgatgagcagctgaaagtcatctttggaaacattgaa
gacatctacagatttcagatgggcttcgtgagagacttggagaagcagtacaacaatgat
gacccccacctcagcgagataggaccctgcttcttggagcatcaagatggcttctggata
tactctgagtattgtaacaaccacctggatgcctgcatggagctctccaaactgatgaag
gacagccgctatcaacacttctttgaggcctgccgcctcttgcagcagatgatcgacatc
gctatcgatggttttcttttgactccagtacagaagatctgcaaataccccttacaattg
gccgagctcctaaagtatactgcccaagaccacagtgattacagatatgtcgcagctgct
ttggctgtcatgagaaatgtgactcagcagatcaatgaacgcaagcgacgtctggagaat
attgacaagattgctcaatggcaggcctctgtcctagactgggagggagatgacatctta
gacaggagctcggaactgatctacactggagagatggcctggatctaccagccctatggc
cgcaaccagcagagagtcttcttcctgtttgaccaccagatggtcctctgcaagaaggac
ctaatccggagagacatcctatactacaaggggcgcattgacatggataaatatgaggtc
attgacattgaagatggcagagatgatgactttaatgtcagcatgaaaaatgctttcaag
ctgcacaacaaggaaaccgaagaagtacatctgttctttgccaagaaactggaggagaaa
atacgttggcttagagctttcagagaagagaggaaaatggtacaagaagatgaaaaaatt
ggctttgagatttctgaaaatcagaagagacaggctgcaatgactgtgagaaaagcgtct
aaacagaaaggtagggttggagaggaagagaaccaaagtctagaactgaaaagagcttgt
gaggttcttcagagattatggtctcctggaaagaaatcctaa

DBGET integrated database retrieval system