KEGG   Rattus norvegicus (rat): 78957
Entry
78957             CDS       T01003                                 

Gene name
Shank1
Definition
(RefSeq) SH3 and multiple ankyrin repeat domains protein 1
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    78957 (Shank1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    78957 (Shank1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   78957 (Shank1)
SSDB
Motif
Pfam: Ank_2 Ank_4 SAM_1 Ank_5 SH3_2 Ank SAM_2 PDZ_6 SH3_1 PDZ SH3_9 FERM_f0 SAM_PNT
Other DBs
NCBI-GeneID: 78957
NCBI-ProteinID: NP_113939
RGD: 621011
Ensembl: ENSRNOG00000019207
Vega: OTTRNOG00000002180
UniProt: Q9WV48
Structure
PDB: 
1Q3O 1Q3P 3QJM 3QJN 3L4F

Position
1
AA seq 2167 aa
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPQGTRGRGSGAPGNLASTRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGTPGPTSGPQGQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIDSGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKASQQAKRLPPP
AISLRSKSMTSELEEMVSPWKKKIEYEQQPAAVPSMEKKRTVYQMALNKLDEILAAAQQT
ISASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYDRPSFLPPGPGLMLRQKSIG
AAEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGG
PFNPSSGGPLPASSPSSFDGPSPPDTRGGGREKSLYHSAALPPAHHHPPHHHHHHAPPPQ
PHHHHAHPPHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTSGAPSPSHHSSSGG
SSGPTQAPALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGSIPSASSPT
SPALPRSEPPPAGPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPDGAGGGGS
SPSPAPATSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTL
FLSTDAGDEDGGDSGLGPGGPPGPRLRHSKSIDEGMFSAEPYLRLESGGSSGGYGAYAAG
SRAYGGSGSSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGTPQP
PPRPPSPRYDAPPPTLHHHSPHSPHSPHARHEPVLRLWGDPARRELGYRAGLGSQEKALT
ASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPPTPHPGVSKAWRTAAPEEPERLPLHVRF
LENCQARPPPAGTRGSSTEDGPGVPPPSPRRVLPTSPTSPRGNEENGLPLLVLPPPAPSV
DVDDGEFLFAEPLPPPLEFSNSFEKPESPLTPGPPHPLPDPPSPATPLPAAPPPAVAAAP
PTLDSTASSLTSYDSEVATLTQGAPAAPGDPPAPGPPAPAAPAPPAPQPGPDPPPGTDSG
IEEVDSRSSSDHPLETISSASTLSSLSAEGGGNTGGVAGGGAGVASGTELLDTYVAYLDG
QAFGGSGTPGPPYPPQLMTPSKLRGRALGTSGNLRPGPSGGLRDPVTPTSPTVSVTGAGT
DGLLALSACPGPSTAGVAGGPVAVEPEVPPVPLPAASSLPRKLLPWEEGPGPPPPPLPGP
LSQPQASALATVKASIISELSSKLQQFGGSSTAGGALPWARGGSGGSTDSHHGGASYIPE
RTSSLQRQRLSEDSQTSLLSKPSSSIFQNWPKPPLPPLPTGSGVSSSTAAAPGATSPSAS
SASASTRHLQGVEFEMRPPLLRRAPSPSLLPASDHKVSPAPRPSSLPILPSGPIYPGLFD
IRSSPTGGAGGSTDPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKP
LGFWTKFDVADWLEWLGLSEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRA
LKFFLER
NT seq 6504 nt   +upstreamnt  +downstreamnt
atgacccacagccccgcgacaagcgaggacgaggaacgccacagtgccagcgagtgtccc
gaggggggctcagaatcggacagctccccagacggaccaggaagaggcccccagggtact
cggggccggggcagcggagcacctggtaacctggcctctacccgaggcctccagggacgc
tccatgtctgtccctgacgacgcccacttcagcatgatggttttcaggattggcatccct
gacttgcaccagacgaaatgcctacgcttcaacccggatgctaccatctggacagccaaa
cagcaagtactctgtgccctgagcgagagtctacaggatgtgctaaactatggactgttc
cagccagccacctcaggccgggatgccaacttcctggaggaagagaggcttctaagagag
taccctcagtcctttgagaaaggggtaccctacctggagttccgctacaagacccgagtc
tacaaacagaccaacctggatgagaaacagctggccaaactgcacacgaagacggggttg
aagaagttccttgaatatgtgcagctcgggacgtctgacaaggtggcgaggctgctggac
aaggggctggaccccaattaccacgactcagattcaggagagacacctttgaccctggcg
gcccagactgaaggctcagtagaggtgattcggacgctgtgcctgggcggggcgcacata
gacttcagggcccgggatggcatgacagcgctgcacaaagctgcatgtgctaggcactgc
ctggcactcacggcacttctggaccttgggggctcccccaactacaaggatcgacgaggg
ctgacccccctgttccacacagctatggttgggggagacccccgctgttgtgagctactt
ctgtacaacagggcccagctgggcattgcagatgagaacggctggcaggaaatccaccag
gcctgccaacgagggcactctcagcacctggaacacctgctcttctatggggctgagcct
ggagcccagaatgcctcaggaaacacggccctgcacatctgtgctctctacaacaaggag
acctgtgccaggatcctcctttatcgcggagcaaacaaggatgtgaaaaataacaacgga
cagacacccttccaggtggctgtgattgctgggaattttgagctgggggaactgattcgt
aaccatcgggaacaggatgtggtacccttccaggagtcccccaagtatgcagcccggcgt
cggggacccccaggcgcagggctgactgtacccccagcgctgctgcgggctaacagcgac
acgagcatggcgctgcctgattggatggtgttttcggccccaggggcctcatcctctggg
acccctggccctacctcaggaccccagggccagtcacagccctcggcccccagcaccaag
ctcagtagtgggaccctcagaagtgccagcagcccccgaggtgcccgggcacgctcccca
tcccgggggagacatcctgaagatgccaagagacaacctcgaggccgacccagctccagc
gggacaccccgagatgggccggctgggggaactgggggctcagggggccctgggggctcc
ctgggtagcagaggcagacgtaggaagctctattcagcggtacctggacgctccttcatg
gcggtgaagtcataccaggcgcaaggcgagggggagatctctctgagtaaaggcgaaaag
atcaaagtgctcagcatcggggaaggaggcttctgggaaggccaggtcaaaggtcgagtt
ggctggttcccttctgactgcctagaagaggtggcaaaccgttcccaggagggaagacaa
gaaagccgaagtgacaaggcaaagagactcttcaggcattacacagtgggctcttacgac
agcttcgatgccccaagtctgatcgatgggattgactcagggagtgattacatcatcaag
gagaagacagtcttactgcagaagaaggacagtgaggggttcgggttcgtgctccggggg
gccaaggcgcagacccccatcgaggaattcacccccaccccggccttcccggcgctgcag
tacctcgagtctgtggacgagggtggcgtggcatggcgggctggactacggatgggagac
ttcctcatcgaggtgaatggacagaatgtagtgaaggttggccaccgccaggtggtcaac
atgatccgacagggaggcaacacactgatggtcaaggtggtgatggtgaccagacaccca
gacatggacgaggctgtccacaagaaagcatcccagcaggctaagcggctcccgccccca
gccatctccctgcgttccaagtctatgacctcagagctggaggaaatggtctccccctgg
aagaagaaaattgaatacgagcaacagcccgcggcagtgcccagcatggagaaaaagagg
actgtgtatcagatggcactcaacaaactggatgagatcttggccgctgctcagcagacc
atcagcgcaagtgagagtcctgggcctggtggcctggcatccctgggcaagcaccgaccc
aaaggattctttgccactgagtcgagctttgatcctcaccaccgctcccagccaagttat
gaccggccttctttcctgcctcctggacccggccttatgctccggcagaaatctatcggg
gctgcggaagacgacagaccctacctagcacccccagccatgaaattcagtcgtagcctg
tcagtccccggttcagaggacatacccccaccacccactacatcaccaccagagccgccc
tatagcacacctccggccccctcctcctccggccgcctcactccctcgcctcggggaggg
ccctttaaccccagttctgggggtccccttcccgcctcctccccttcatctttcgatggg
ccatctcctcctgacacccgtggtgggggccgagaaaagagcctatatcacagcgcagcc
ctgccccctgcccaccaccatccacctcatcaccaccatcatcacgcgccacctccccag
ccccaccatcaccatgcacatcctcctcacccaccggagatggagacaggaggttccccc
gacgatcccccacctcgattggccctgggaccccagcccagccttcgaggctggcgaggt
ggaggacccagcccgacctcgggggccccatcaccttcccaccacagtagcagcggaggc
agcagcggccctactcaggctcccgccctgcgctacttccaactgcccccgagggcggcc
agtgcggctatgtatgtaccagcacgttccggccgcggtcgcaagggcccactggtcaag
cagaccaaagtggaaggcgagccccaaaagggcagcatcccttccgcgtcctctccaaca
tccccggcgttgcctcggtctgaaccacctccggccgggccgtcggagaaaaattccatc
cctatcccgaccatcatcatcaaagccccatctaccagtagcagcggccgcagcagtcag
ggaagcagcacagaggctgagccccccacccagcccgatggcgcgggcggcggcggatcc
tcgcctagccctgcacctgccacgtcccctgtgccgccatccccgtcgcccgtgcccact
cccgcgtcacccagcggcccggccaccctggatttcactagccagtttggagcagcccta
gtaggcgcggcgcggagggagggaggctggcagaacgaagcccggcggcggtccacgctg
ttcctgtccaccgacgcaggagatgaggatggaggcgacagcgggctgggcccggggggg
cccccgggtccccggctgcgccattccaaatccattgacgaaggcatgttctccgcagag
ccgtacctccggctggagtcagggggcagcagtgggggctacggggcctacgcagcgggc
agccgagcctacgggggcagcgggagcagcagcgccttcaccagcttcctccccccgcgg
cccctggtgcatccgctgaccggcaaagccttggatcccgcctctccgctggggttggcc
ttggccgcccgggagcgggccttgaaggagtcctcggagggtgggggcacccctcagccg
cccccgagacctccatcaccacgctacgacgccccaccgcctacccttcaccaccactcg
ccccattcaccccattcgccacatgcgcgtcacgagccagtgttgcgcctctggggggac
cccgcgcgccgggagctggggtaccgggcaggcctagggagtcaggagaaggcccttacc
gccagtccacctgcagctcgccgctccctactgcaccgtctgcccccgacggctcccggg
gtcgggccgctcctgctgcagctggggccggagcccccaactccccatcctggggtgagc
aaggcctggcgcacagcagccccggaggagccggagcggctgccgctgcacgtgcgattc
cttgagaattgccaagcccggcctcccccagctggcacgagagggtcctctactgaagat
gggcctggggtcccgcctcccagccctcgcagagtcttgccaacctctcccacctcccca
cgaggcaacgaggagaacggccttccgctactggtcctgccaccgccagccccttcggtg
gatgtggacgacggcgagttcttgtttgcggagccgctgcctccacccctggagttttcc
aatagtttcgaaaagccagagtcgcctctcacacccgggcctcctcacccactacctgac
cctccctccccggctacccctctacccgcagccccacctcccgctgtagccgcagcccct
cccaccttggactccacagcatccagcctgacctcttacgacagcgaagtggccacactg
acccagggggctcccgcggctcctggggatcctccagctccaggcccgccggccccggca
gccccagctcccccagcaccgcagccaggccctgatcctccacctggcacagattctgga
attgaggaggtggacagtcggagtagcagtgatcacccgctggagaccatcagcagcgca
tccacactcagcagcttgtccgccgaaggaggaggcaatacagggggcgtggctgggggc
ggggccggggtggccagtgggacggagctcctggacacctacgttgcctacctggatggc
caggccttcgggggcagtggaactcctggcccaccatatcctccccagctcatgactcct
tctaagctccggggcagggcgcttgggactagtggaaatttaagacctggtcccagtggg
ggactccgagatcctgtcacccccaccagccccactgtctctgtgaccggagctggaaca
gatgggctactggccttgagtgcttgccctggaccctcaacggcaggtgtggcagggggt
cccgtggcagttgagccagaagtcccgcctgtacctttgcccgctgcctcatccctgcct
cggaagctattaccgtgggaggagggtccgggaccaccaccaccacccctgccagggccc
ctgtcccagcctcaggcctctgccttggccacggtcaaagccagcatcatcagcgaactc
agctccaagctccagcagtttggtgggtcctctaccgcaggaggagctctgccttgggct
cggggaggcagcgggggcagcacagacagccaccacggaggagccagttacatcccagag
aggacgtcctccctgcagcggcagaggctctctgaagactcccagacctctctcctctcc
aaacccagcagcagcatctttcagaactggcctaaaccccctctgccaccactccccact
gggtctggggtctcctcttcaacagctgcagccccgggagctacatccccttcagcctca
tctgcctcagcttccaccagacacctgcagggtgtggaatttgagatgcggcctccgctg
ctccgccgggcacccagcccctcgctgctgcctgcctcggatcacaaggtcagcccagcg
cccaggccttcctctttgcccatcctgccttcaggacccatctacccgggcctcttcgac
atccgtagctctccaaccggaggggcgggaggctcgactgaccccttcgctcccgtcttt
gtgccaccacaccccgggatatctgggggtcttggaggagccttgtctggggcctctcgc
tccctatcacccacccgcctgctctcgctgcccccggacaagccgttcggcgccaagcct
ctagggttctggaccaagtttgacgtcgccgattggctagagtggctgggcttgtcggag
caccgagcccagttcctggaccacgagattgatggctcccatctgcctgccttgaccaag
gaggactatgtggacctgggtgtaaccagggtgggccaccgtatgaacattgaccgggct
ctcaaatttttcctggagaggtga

DBGET integrated database retrieval system