KEGG   Rattus norvegicus (rat): 81707
Entry
81707             CDS       T01003                                 

Gene name
Mmp14
Definition
(RefSeq) matrix metalloproteinase-14 precursor
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04668  TNF signaling pathway
rno04912  GnRH signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81707 (Mmp14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    81707 (Mmp14)
   04928 Parathyroid hormone synthesis, secretion and action
    81707 (Mmp14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81707 (Mmp14)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     81707 (Mmp14)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   81707 (Mmp14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 Metallopep DUF4953 Reprolysin_3 HTH_17 Peptidase_M66 Reprolysin_5 SKG6
Other DBs
NCBI-GeneID: 81707
NCBI-ProteinID: NP_112318
RGD: 620198
Ensembl: ENSRNOG00000010947
UniProt: Q10739
Position
15
AA seq 582 aa
MSPAPRPSRSLLLPLLTLGTTLASLGWAQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQRFYGLQVTGKADSDTMKAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIL
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTT
SRPSVPDKPRNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctcccgcccctcgaccctcccgcagcctcctgctccccctgctcacgctcggcacc
acgctcgcctccctcggctgggcccaaagcagcaacttcagccccgaagcttggctgcag
cagtatggctacctacctccaggggacctgcgtacccacacacaacgctcaccccagtca
ctctcagctgccattgccgccatgcaaaggttctatggtttacaagtgacaggcaaggcc
gattcggacacgatgaaggctatgaggcgccctcgctgtggtgttccagataagtttggg
actgagatcaaggccaatgttcggaggaagcgctatgccattcagggcctcaagtggcag
cataatgagatcactttctgcatccagaattatacccccaaggtgggcgagtatgccaca
ttcgaggccattcggaaagccttccgagtatgggagagtgccacgccactgcgcttccga
gaagtgccctatgcctacatccgggagggtcatgagaagcaggctgacatcatgatcttg
tttgctgagggtttccatggcgacagcacaccctttgatggtgaaggaggcttcctggct
catgcctatttcccaggccccaatatcggaggggatacccactttgattctgctgagccc
tggactgtccaaaatgaggatctaaatgggaatgacatcttcttggtggctgtgcatgag
ttggggcatgccctaggcctggaacattccaacgacccctccgccatcatggctcccttt
taccagtggatggacaccgagaacttcgtgttgcctgatgacgatcgccgcggcatccag
caactttatggaagcaagtcagggtcacccacaaagatgccccctcaacccagaaccacc
tctaggccctctgtcccagataagcccagaaaccccacctatgggcccaacatctgtgat
gggaactttgacaccgtggccatgctccgaggagagatgtttgtcttcaaggagcgatgg
ttctggcgggtgaggaataaccaagtgatggacggatacccaatgcccattggccaattc
tggaggggcctgcctgcatccatcaacactgcctatgagaggaaggatggcaaatttgtt
ttcttcaaaggagataagcactgggtgtttgacgaagcttccctggaacccggatacccc
aagcacattaaggagctgggccgaggactgcccacggacaagattgatgcagctctcttc
tggatgcccaacgggaagacctacttcttccggggaaataagtactaccgcttcaatgag
gagttcagggcagtggacagcgaataccccaaaaacatcaaagtctgggaaggaatccct
gagtctcccagaggctcattcatgggtagcgatgaagtcttcacatacttctacaaaggg
aacaaatactggaaattcaacaaccagaagctgaaggtagagccagggtaccccaagtca
gctctgcgggactggatgggctgcccttcggggggccggcccgacgaggggactgaggag
gagacggaggtgatcatcatcgaggtggatgaggagggcagcggagccgtgagtgcagct
gctgtcgttctgccggtgctgctgctgctcctggtactggcagtgggccttgctgtcttc
ttctttagacgccatgggacacccaagcgactgctttactgccagcgttcactgctggac
aaggtctga

DBGET integrated database retrieval system