KEGG   Rattus norvegicus (rat): 81750
Entry
81750             CDS       T01003                                 

Gene name
Pros1
Definition
(RefSeq) vitamin K-dependent protein S precursor
  KO
K03908  protein S
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    81750 (Pros1)
SSDB
Motif
Pfam: Laminin_G_1 EGF_CA Gla FXa_inhibition Laminin_G_2 cEGF EGF EGF_3 hEGF OMPdecase
Other DBs
NCBI-GeneID: 81750
NCBI-ProteinID: NP_112348
RGD: 620971
Ensembl: ENSRNOG00000048723
UniProt: M0R5R0
Position
7
AA seq 675 aa
MRVLSVRFRVLLACLALVLPVSETNFLSKERASQVLVRKRRANTLLEETKKGNLERECIE
ELCNKEEAREVFENNPETDYFYPKYLGCLGAFRVGAFSAARQSANAYPDLRSCVNAIPDQ
CDPMPCNEDGYLSCKDGQGAFTCICKPGWQGDKCQFDINECKDPSNINGGCSQTCDNTPG
SYHCSCKIGFAMLTNKKDCKDVDECSLKPSVCGTAVCKNIPGDFECECPNGYRYDPSSKS
CKDVDECSENTCAQLCVNYPGGYSCYCDGKKGFKLAQDQRSCEGIPVCLSLDLDKNYELL
YLAEQFAGVVLYLKFRLPDITRFSAEFDFRTYDSEGIILYAESLDHSNWLLIALREGKIE
VQFKNEFSTQITTGGNVINNGIWNMVSVEELDDSVSIKIAKEAVMNINKLGSLFKPTDGF
LDTKIYFAGLPRKVESALIKPINPRLDGCIRGWNLMKQGALGAKEIVEGKQNKHCFLTVE
KGSYYPGSGIAQFSIDYNNVTNAEGWQINVTLNIRPSTGTGVMLALVSGDTVPFALSLVD
SGSGTSQDILVFVENSVAAHLEAITLCSEQPSQLKCNINRNGLELWTPVRKDVIYSKDLQ
RQLAILDKTMKGTVATYLGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDI
RAHSCPSVRKIQKNF
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgagggtcctgagcgtgcgctttcgggtgctactggcctgcctcgccctggtgctccct
gtctcagagacaaacttcttgtcaaaagaacgagcttcacaagtcctggtgaggaagcgc
cgtgcaaataccttgctcgaagaaactaaaaagggcaaccttgaaagagagtgcattgaa
gaactctgcaataaggaggaagccagggaggtctttgaaaataatcccgaaacggattat
ttttatccaaaatatttaggttgtctgggcgcattccgagttggcgcattcagtgctgcg
aggcagtcagctaatgcttaccctgacctcaggagctgtgtcaatgccatcccagaccaa
tgtgaccctatgccatgcaatgaagatgggtatctgagctgcaaagacggccaaggtgct
tttacttgcatctgtaaaccaggctggcaaggagacaagtgtcagtttgatataaatgaa
tgcaaagatccctcaaatatcaatgggggctgtagccagacttgtgacaatactcctgga
agttaccactgctcctgtaaaattggctttgctatgctcacaaataagaaagactgcaaa
gatgtggatgagtgctctctaaagccaagtgtctgtggcacagctgtgtgcaagaacatt
ccaggagacttcgaatgtgaatgtcccaatggctacagatatgatccctcatcaaaatct
tgtaaagatgtcgatgaatgctctgaaaacacctgtgcccaactgtgtgtcaattacccc
ggaggctactcttgttactgtgatgggaagaaaggattcaaacttgcccaagatcagagg
agttgtgagggtattccagtgtgcctttccttggaccttgacaaaaattatgaattatta
tatttggcggaacagttcgcaggagttgtcttatatctgaaatttcgattgccagatatc
accaggttttcagctgaatttgattttcggacatatgattcagagggcatcatactgtat
gcagaatctctcgatcactcaaattggctcctgattgcacttcgtgaagggaagattgaa
gttcagtttaagaatgagttttcaacccaaatcacaactggaggcaatgttattaacaat
ggtatatggaatatggtgtctgtggaagaattagacgacagtgttagcattaaaatagct
aaggaggccgtgatgaatattaataaacttgggagtctttttaaacctaccgatggattt
ctggacaccaaaatatactttgcaggattacctcggaaggtggaaagtgcactcattaag
ccgattaatcctcgtctggatggatgtatacgaggctggaacttgatgaaacaaggagct
ttgggtgcaaaggaaatagttgaaggaaaacaaaataaacattgcttcctcactgtggag
aagggctcctactaccctggttcaggaattgctcagttcagcatagactacaataatgta
actaatgcagagggttggcaaataaatgtgaccttgaatattcgcccgtccactggcact
ggagtcatgcttgctttagtttctggggacacagtgccctttgccttgtccttggtggat
tctggctctggaacttctcaggacattctggtatttgttgaaaattcagtagcagctcac
ttagaagccataactctgtgctcggaacagccatcccagctgaaatgtaacattaacaga
aatggactggaactgtggaccccagttagaaaagacgtcatttactctaaagatctccaa
aggcaactcgccatcttggacaaaacaatgaaaggaaccgtggccacttacctgggtggc
gttccagatatttccttcagtgccacaccagtgaatgctttttacagcggctgcatggaa
gtgaacatcaacggggtacagttggatctggatgaagccatttccaaacataatgacatt
agagctcactcctgtccgtcagtgaggaaaatccagaagaacttctaa

DBGET integrated database retrieval system