KEGG   Rattus norvegicus (rat): 84010Help
Entry
84010             CDS       T01003                                 

Gene name
Dll1
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    84010 (Dll1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    84010 (Dll1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84010 (Dll1)
  09162 Cancer: specific types
   05224 Breast cancer
    84010 (Dll1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    84010 (Dll1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA cEGF EGF_3 EGF_2 ECSCR
Motif
Other DBs
NCBI-GeneID: 84010
NCBI-ProteinID: NP_114452
RGD: 70949
Ensembl: ENSRNOG00000059984
UniProt: P97677
Position
1q12
AA seq 714 aa AA seqDB search
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTAVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGERGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPAGFSGFNCEKKIDLCSSSPCSNGAKCV
DLGNSYLCRCQTGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGRNCSAP
VSRCEHAPCHNGATCHQRGQRYMCECAQGYGGANCQFLLPEPPPDLIVAAQGGSFPWVAV
CAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPDPCGGETETMNNLANCQREKDVSVSIIG
ATQIKNTNKKADFHGDHGADKSSFKARYPTVDYNLIRDLKGDEATVRDAHSKRDTKCQSQ
GSVGEEKSTSTLRGGEVPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIATEV
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtcggagcgcgctagcccttgccgtggtctcagccctgctgtgccaggtctgg
agctctggcgtatttgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggctctggcccgccgtgcgcctgcaggaccttctttcgc
gtatgcctcaagcattaccaggccagcgtgtccccggagccaccctgcacctacggcagt
gcggtcaccgcagtgctgggtgtcgactccttcagcctgcctgatggcgcaggcatcgac
cccgccttcagcaaccccatccgattccccttcggattcacctggccaggtaccttctct
ctgatcattgaagccctccacacagattctcctgacgacctcgcaacagaaaacccagaa
agactcatcagccgcctgaccacacagaggcacctcactgtgggagaagagtggtctcag
gaccttcacagtagcggccgcacagacctccgctactcttaccggtttgtgtgtgatgaa
cactactatggagaaggctgctccgtgttctgccgaccgcgggatgatgcctttggccac
ttcacctgcggggagagaggggagaagatgtgcgaccctggctggaaaggccagtactgc
actgaccccatttgtctgccaggctgtgatgaccaacatggatattgtgacaaaccgggg
gaatgcaagtgcagagttggctggcagggccgctactgcgatgaatgcatccgataccca
ggctgtctccatggtacctgccagcagccctggcagtgtaactgccaggaaggctggggg
ggcctcttctgcaaccaggatctgaactactgcactcaccataagccatgcaggaacgga
gccacctgcaccaacacgggccaggggagctacacatgctcttgccgacccgggtataca
ggggccaactgtgagctggaggtagatgagtgtgctcccagcccctgcaggaatggaggg
agctgcacggatcttgaggacagctactcttgcacctgccctcctggcttctatggcaag
gtctgtgagctgagcgccatgacgtgtgcagatggtccttgcttcaatgggggacgatgt
tcggataaccccgatggaggctacacctgccattgccctgcgggcttctctggcttcaac
tgtgagaagaagattgatctctgtagctcttccccttgttctaacggtgccaagtgtgtg
gacctcggcaactcctacctgtgccgatgtcagactggcttctccgggaggtactgcgag
gacaatgtggatgactgtgcctcttctccctgtgcaaacgggggcacctgccgggacagt
gtgaacgatttctcctgtacctgcccacctggctacacaggcaggaactgcagcgcccct
gtcagcaggtgtgagcatgcaccctgtcataacggggccacctgccaccagaggggccaa
cgctacatgtgtgagtgcgcccagggctatggcggcgccaactgccagttcctgctccct
gagccaccaccagacctcatagtggcggcccagggcgggtccttcccctgggtggctgtg
tgtgccggggtggtgcttgtcctcctgctgctgctgggctgtgctgctgtggtggtctgc
gtccggctgaagctacagaaacaccagcctccgcctgatccttgcgggggagagacagag
accatgaacaacctagccaattgccagcgtgagaaggatgtttctgttagcatcattggg
gctacacagatcaagaacaccaacaagaaggcggactttcatggggaccatggtgctgac
aagagcagctttaaggcccgataccccactgtggactataacctcattcgagacctcaag
ggagatgaagccacggtcagggatgcacacagcaaacgtgacaccaagtgccagtcacag
ggctctgtaggagaagagaagagcacctcaacgctcaggggtggggaggttcccgacaga
aaaaggcccgagtctgtctactctacttcaaaggacaccaagtaccagtcggtgtatgtt
ctatctgcagaaaaggatgagtgtgttatagcgactgaggtttaa

DBGET integrated database retrieval system