KEGG   Rattus norvegicus (rat): 84474
Entry
84474             CDS       T01003                                 

Gene name
Ddx1
Definition
(RefSeq) DEAD-box helicase 1
  KO
K13177  ATP-dependent RNA helicase DDX1 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    84474 (Ddx1)
   03016 Transfer RNA biogenesis [BR:rno03016]
    84474 (Ddx1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     84474 (Ddx1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    84474 (Ddx1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    84474 (Ddx1)
SSDB
Motif
Pfam: DEAD Helicase_C SPRY CMS1 ResIII DUF5766 Paramyxo_PNT
Other DBs
NCBI-GeneID: 84474
NCBI-ProteinID: NP_445866
RGD: 619903
Ensembl: ENSRNOG00000006652
UniProt: Q641Y8
Position
6q15
AA seq 740 aa
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKATIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATRGLLRGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPAHIKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKAPDSYVVKSQHTGNAQVSQTKFLPNAPKALIVEPSRELAE
QTLNNVKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKNHIRTDDVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSNRGKGCYNTRLKEDGGCTIWYNEMQLLS
EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGNYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggcggccttctccgaaatgggtgttatgcccgagattgcacaagccgtggaggagatg
gattggcttctacccactgatatccaggcagaatctatcccattgatcctaggaggaggt
gatgtacttatggctgcagaaacgggaagtggaaaaactggtgcatttagtattccagtt
atccagatagtgtatgagactctgaaagaccaacaggaaggaaagaaagggaaagcaact
attaaaactggtgcttctgtgctcaacaagtggcagatgaacccatatgatagagggtct
gcttttgcaattgggtcagatggtctgtgttgtcagagcagagaggtgaaggagtggcat
gggtgcagagcgactagaggactgctgagagggaagcactactacgaagtatcctgtcat
gaccaagggctgtgcagagttgggtggtccaccatgcaggcttccttagacctgggtact
gacaagtttggatttggcttcggtggaacaggaaagaaatctcataataaacaatttgat
aattatggagaggaattcactatgcatgacaccattggatgttacttagacatcgataaa
gggcacgtgaagttctctaagaatggaaaagaccttggtctggcatttgaaatacctgca
cacataaaaaaccaagccctcttccctgcctgtgttttgaagaatgctgaattgaaattt
aactttggtgaagaagaatttaagtttccaccaaaagatggttttgttgctctttccaag
gcccctgatagttacgtcgtcaaatcgcagcacacaggtaatgcacaggtgtcacaaaca
aaatttctccctaatgctccaaaagctcttattgtggaaccctccagagagttagctgag
caaaccttgaacaatgtgaaacagtttaagaagtacatcgataatcctaaattgcgggag
cttctcataattggtggcgttgcagctcgggatcagctctccgttctggataatggggtt
gatattgtcgtcggtactccaggaagattagatgatttggtgtcaactggaaagctcaac
ttgtctcaagttagattcctggtcctggatgaagcagatgggcttctctctcaaggttat
tctgactttattaacaggatgcacaaccagattcctcagattacttctgatgggaaaaga
cttcaggtgattgtttgctctgctactctgcattcttttgatgtaaagaaactatctgag
aagataatgcattttcccacgtgggtggatttgaaaggagaagattctgttcctgatact
gtgcatcatgtcgttgttcctgtgaacccaaaaactgacaggctctgggaaaggctgggg
aagaaccacattcgaaccgatgatgtccatgcaaaggataacacaagacctggtgccaac
agtccagagatgtggtctgaagctattaaaatactgaagggggagtatgctgtccgagca
atcaaggagcacaagatggatcaagcaattatcttctgtagaacgaaaattgactgtgac
aacttggagcagtactttatgcagcaaggaggaggacctgataaaaaaggacaccaattc
tcatgtgtatgtcttcatggtgacagaaagcctcacgagagaaagcagaacttggaacga
tttaagaaaggagacgtaagattcctgatttgcacagacgtagctgccagaggaattgac
atccacggtgttccttatgttattaatgtcaccctgcctgatgaaaagcagaattatgtg
caccggattggcagagtggggcgagctgaaaggatgggcctggctatttccctggtggca
acagagaaagaaaaggtttggtatcacgtatgcagcaaccgtgggaagggatgctataac
actagactcaaggaagatggcggctgtactatctggtacaatgaaatgcagctactttct
gagatagaagaacacctgaactgtaccatttcccaggttgagccagatataaaggttcca
gtggatgagtttgatgggaaagttacatatggtcagaaaagagctgctggcggtgggaac
tataaaggccatgtggacatcctggcacctaccgttcaagagttggctgcccttgaaaag
gaagcacagacatctttcctacaccttggctaccttcccaaccagctgttcagaaccttc
tga

DBGET integrated database retrieval system