KEGG   Ralstonia pickettii 12D: Rpic12D_0545
Entry
Rpic12D_0545      CDS       T00925                                 

Definition
(GenBank) type II secretion system protein E
  KO
K02283  pilus assembly protein CpaF [EC:7.4.2.8]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0545
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0545
Enzymes [BR:rpf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Rpic12D_0545
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_0545
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0545
SSDB
Motif
Pfam: T2SSE ABC_tran AAA_16 AAA_28 Zeta_toxin AAA_7 AAA_29 DEAD FtsK_SpoIIIE Sigma54_activat AAA_23 Mg_chelatase AAA_2 Sigma54_activ_2 cobW VirE RsgA_GTPase Pox_A32 TsaE KAP_NTPase
Other DBs
NCBI-ProteinID: ACS61850
UniProt: C6BDB5
Position
1:complement(576660..578024)
AA seq 454 aa
MSLREQLFQQAGEALPQRVAQANGASMPASPAYQQVAMDVHQIIIDRVELGRLQQLAPDQ
IKRELAQLVERIVDEGKHQLNEAERRRLVNDVQDEMLGYGPLETLLADPTVSDILVNTYK
RVYVERRGKLELTSVTFLDDAHLMRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIP
PSAIDGPLLSIRRFAVNPLTIDDLVGFNTLTPAMAQLIDAMVKAKLNILISGGTGSGKTT
LLNILSGYIPPDERIVTIEDAAELQLRQNHVLRLETRPANIEGRGEITQRALVKNALRMR
PDRIILGEVRGAEALDMLHAMNTGHEGSLATIHANTPRDALTRLENMISMAGMQLPPRTM
RQQITSALTVVLQVSRLTDGFRKLMSVQEITGMEGEVVNMQEIFAFRRKGIDQDGRIRGH
FCATGVRPKFSERLKMFGIQLPETLYDPAVLHEI
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtccctgcgagaacaactcttccagcaagccggcgaagccctgccacagcgcgttgca
caagcgaatggcgccagcatgccggccagccccgcctatcagcaagtcgcaatggacgtc
caccagatcatcatcgaccgcgtggagctgggccgtctgcagcaactcgcacccgatcag
atcaagcgtgagctggcccaactggtggagcgcatcgtcgacgaaggcaagcatcaactc
aacgaggccgagcgccgccgcctggtgaacgacgtacaggacgagatgctcggctatggc
ccgctcgaaacgttgctggcagaccccaccgtctccgacatcctcgtcaacacgtacaag
cgcgtctatgtggagcggcgcggcaagctcgagctgaccagtgtgacgtttctcgacgat
gcgcatctgatgcgcgtgatcgagaaaatggtatcgagagtcggacgccgcatcgacgag
tcaagcccgatggtggatgcgcgcctgcctgatgggtcccgtatcaacgccatcattccg
ccttctgcaatcgacggcccgttgctgtcgatcaggcgctttgcggtgaatccgctgacg
attgatgatctcgtcggcttcaacacgctcacgccagccatggcgcagttgatcgatgca
atggtcaaggccaagctgaacatcctgatttcgggcggcacgggcagcggcaagaccacg
ctgctgaacattctctcgggctacatcccgccggacgagcgcatcgtcaccattgaagac
gcggctgaactgcaactgcgtcagaaccacgtgctgcgtctggaaacacgcccggccaac
atcgaaggccgtggtgagatcacacagcgcgccctggtgaagaacgcgctgcgcatgcgc
cccgaccgcatcatcctgggcgaggtacgcggcgcggaggcgctcgacatgctgcacgcg
atgaacaccggacatgaggggtcgctcgccaccatccatgccaacacaccgcgtgatgca
ctcacccgcctggaaaacatgatcagcatggcaggaatgcaactgccaccgcgcacgatg
cggcagcagatcacctctgcactcacggtggtgttgcaggtctcgcgcctgaccgacggt
tttcgcaagctcatgagcgtgcaggagatcaccggcatggaaggcgaggtggtgaacatg
caggagatcttcgccttccgccgcaaaggcattgaccaggacggacgcatccgtggtcac
ttttgcgccaccggcgtgcggcccaagttttcggaacgcctgaagatgttcggcatccag
ctgccggaaacgctctacgacccagccgttctgcacgaaatctga

DBGET integrated database retrieval system