KEGG   Ralstonia pickettii 12D: Rpic12D_0673
Entry
Rpic12D_0673      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87
Other DBs
NCBI-ProteinID: ACS61974
UniProt: C6BE14
Position
1:705383..707542
AA seq 719 aa
MAQSQAVEVLLRPAVELYTVAVCAGAAFLCLVAPWSLALSPLLGLGSALAFLTLGALRFH
DAWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFRWDQRHTHRLMQTYRPEFRRYV
EPTAIYRAARHFEQRLEFAPYPLSKLAKALAWDSPLNPARPLPPVGGLPRLHGIEPHEVD
VTLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKVGGQHEVVIVFDPKGDADLLKRM
YVEAKRAGREGEFYVFHLGWPDVSARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFARSEPKAWEIIVQLEAKL
NDKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLGDPRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGIDDGLPGASAGVKVPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYT
QTMSDIEARIGNRAKAGQVIGNFNNLFMLRVRETITAELLTRQLPKVEVYTTTVMSGATD
SSDPTGNTAFTSNTQDRISSNSVPLIEPAHVVGLPKGQCFALIEGGHLWKVRMPLPAPDL
DEAMPKDLQELAGYMRQHYVEAGDWWDSKGLPGLQDQALPDELLADFKQMASMDEGAAA
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggcccaatcccaagccgtcgaagtcttgctgcggccagcggtggagctttacaccgtc
gcggtctgtgcgggcgccgcgtttctgtgcctggtggccccgtggtcgctcgcgctgagc
cccttgctcggcctgggcagcgcgctggccttcctgaccctcggcgcgctgcgtttccac
gacgcctgggcgatcctgcgctaccggcgcaacatccgccgcctgccgcgctacgtgatg
accagccgcgatgtgccggtcagccagcagcggctgttcgtcggccggggtttccgctgg
gaccagcgccacacgcaccggctgatgcagacctaccggccggagttccgccgctacgtc
gaaccgacggcgatctaccgggcggcacggcacttcgagcagcgcctggagttcgcgccg
taccccctgtccaagctggcgaaggccctggcctgggacagcccgctcaacccggcgagg
cctctgccgccagtcggtggtctgccgcgcctgcacggcatcgagccacacgaggtcgac
gtcaccctgccgctgggcgagcgcgtcggccattcgctggtgctcggcaccacccgcgtc
ggcaagacccgcctggccgaactgttcatcacccaggacatccgccgcaaggtgggcggc
cagcacgaggtcgtgatcgtcttcgaccccaagggcgacgccgatctgctcaagcgcatg
tacgtggaagccaaacgcgccgggcgcgaaggcgagttctacgtcttccatttgggctgg
ccggacgtcagcgcccgctacaacgccgtggggcggttcgggcgcatcagcgaagtcgcc
acgcgcatcgcgggccagctctccggtgaaggcaacagcgccgcgttccgcgagttcgcc
tggcgcttcgtcaacatcatcgcccgtgccttggtcgagctggggcagcggcccgactac
ctgctgatccagcgccacgtcatcaacatcgacgcgctgttcatcgagtacgcccagcac
tacttcgccaggagcgagcccaaggcctgggagatcatcgtccagctcgaagccaagctg
aacgacaagaacatcccgcgcaacatgatcggacgggagaagcgcgtcgtcgcgctggag
cagtacctgtcgcaggtgcgcatctacgacccggtgctcgacgggctgcgcagcgccgtg
cgctacgacaggacgtacttcgacaagatcgtggcgtcgctcctgccgctgctggagaag
ctgaccaccggcaagatcgcgcagttgctggcgccgaactactcggacctgggcgacccg
cggccgatcttcgactggatgcagatcatccggaagcgggccgtggtctatgtcgggctg
gatgcgttgtcggacgcggaggtcgcggccgcagtgggaaattccatgttcagcgatctc
gtctcggtcgccgggcacatctacaagttcggtatcgacgatggcctgccgggcgcgtcg
gcaggcgtgaaggtgccgatcaacgtacatgccgacgagttcaacgagctgatgggcgac
gagttcatcccgatggtcaacaagggcggcggcgccggggtgcaggtcacggcctatacg
caaaccatgagcgacatcgaggcccgcatcggcaaccgcgccaaggccggccaggtcatc
gggaacttcaacaacctgttcatgctgcgcgtgcgcgagaccatcacggccgagctgctg
acgcggcaactgcccaaggtcgaggtctacacgacgacagtgatgagcggcgccaccgac
agttccgacccgaccggcaacaccgcgttcacgtcgaacacgcaggaccgcatcagcagc
aacagcgtgccgctgatcgaaccggcgcacgtcgtcggcctgcccaaggggcagtgcttc
gcgctgatcgagggcggccacctgtggaaggtgcgcatgcccttgccggcgcccgacctc
gacgaggccatgccgaaggatctgcaggaactggccgggtacatgcggcagcactacgtc
gaggccggcgactggtgggacagcaaggggcttcccggcctgcaggatcaggcgctgccc
gacgagctgctggcggacttcaagcagatggcgagcatggatgaaggggccgcggcatga

DBGET integrated database retrieval system