KEGG   Ralstonia pickettii 12D: Rpic12D_2705
Entry
Rpic12D_2705      CDS       T00925                                 

Definition
(GenBank) type IV-A pilus assembly ATPase PilB
  KO
K02652  type IV pilus assembly protein PilB
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2705
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2705
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2705
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2705
SSDB
Motif
Pfam: T2SSE T2SSE_N AAA_22 AAA_16 AAA_7 AAA_30 Ad_Cy_reg AAA_14 FtsK_SpoIIIE AAA_11 Cyanate_lyase DUF2075 ATPase_2 AAA_29
Other DBs
NCBI-ProteinID: ACS63976
UniProt: C6BEG4
Position
1:2854539..2856266
AA seq 575 aa
MTLGLALAQSRRIAPTLLTQLEQSAREKRTQLIDELVGSGIMSAHDLAVFVAGKYQMPLL
DLAQYKLDTVPAVLSANKHFAQLRLLPLGRRENRLILATSDPSDPKPIEELRQKMNVAIE
TVIVEHDKLVRQLSLANEAPAEIKSLFPKQEATQIEYDAGAAAATRRTTPDGIDDAPVVR
FLQKLFTEALLRGASDLHFEPFETFYRVRFRIDGILAQVAQPPLDIRDKIATRIKVLSRL
DISEKRVPQDGRMKLLITVPKDRKDKDNKETIERAIDFRVSTLPTLFGEKIVIRILESST
ERLDIDQLGYEPEQKQLLLDVIKRPYGMVLVTGPTGSGKTVSLYTFLNRLNQGDINISTA
EDPAEIQLPGINQVNVNDKAGLTFAAALKSFLRQDPDIIMVGEIRDLETADISIKAAQTG
HLVFSTLHTNDAPTTLTRLMNMGVAPFNIASSVLLITAQRLARRLCKECKKPGPLPKETL
LDAGFTEADLDGSWQPYHPVGCEICNGSGYKGRVGIYQVMPITEAIQEIILTHGTALQIA
EQARKEGVLSLRESGLRKVKQGLTSLEEVLATTNQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgacactcggactcgctctagcgcagagccggcggatcgcgccgacgctacttacccag
cttgaacagagcgcgcgtgagaaacgcacccaactgatcgacgaactggtgggcagcggg
atcatgagtgcgcacgacctcgctgtgttcgtggccggcaagtaccagatgccgctgctg
gacctggcacagtacaagctcgacaccgtgccggccgtgctgtcggccaacaagcacttt
gcccagttgcgcctgttgccgctgggccgtcgcgagaaccgcctcatcctcgccacgtcc
gacccgagcgatccgaagccgatcgaagagctgcgtcagaagatgaacgtggccatcgaa
acggtcatcgtcgaacacgacaagctggttcgccaactcagcctcgccaatgaggcgccg
gccgagatcaagtcgctcttccccaagcaggaagccacgcagatcgaatacgatgcgggc
gctgccgccgccacgcgtcgcaccacccccgacggcatcgacgatgcccctgtggtgcgc
ttcctgcagaagctctttaccgaagccttgctgcgcggcgcatcggatttgcatttcgag
ccctttgaaacgttttaccgcgtgcgtttccgcatcgacggcatcctcgcgcaggtcgcg
cagccgccgctcgatatccgcgacaagatcgcgacgcgcatcaaggtgctgtcgcgcctc
gacatctcggaaaagcgtgtgccgcaagacggccgcatgaagctgctgatcactgtcccg
aaagaccgcaaggacaaggacaacaaagagacgatcgagcgcgccatcgacttccgggtg
tcgacgctgccgacgctgttcggcgaaaagatcgtgatccggattctggagtcgtccacc
gagcggctcgatatcgaccagcttggctatgagccggagcaaaagcagttgctgctcgac
gtcatcaagcggccgtacggcatggtgctcgtgacggggccaaccggatcgggcaaaacc
gtgtcgctgtacacgttcctgaacaggctgaaccagggcgacatcaatatctccaccgcc
gaagacccagcggaaatccagttgcccggcatcaaccaggtcaacgtgaacgacaaggct
gggctgacctttgcggcggcgctgaagtcgttcctgcggcaggatccggacatcatcatg
gtgggcgaaatccgagatctggagacggccgacatctcgatcaaggctgcgcagaccggt
cacctggtgttttccacgctgcacaccaacgacgcgccgaccacgctgacccgcttgatg
aacatgggggttgcgccattcaacatcgcgtcgtcggtgctcttgatcacggcacagcgg
ttggcgcgacggctgtgcaaggaatgcaagaagcccggtccgctgcccaaggaaacgctg
ctcgatgcaggctttaccgaggccgacctagacggctcatggcagccgtatcacccggtc
ggctgcgagatctgcaacggcagcggctacaagggacgggtcggcatctaccaggtcatg
ccgattaccgaagcgatccaggaaatcattctcacacacggcacggcgctgcagatcgcc
gagcaagcgcgcaaggaaggcgtgctgtcgctgcgcgaatccggcttgcgaaaagtgaag
caggggctgacttccctcgaggaagtgctggccacaacgaaccaataa

DBGET integrated database retrieval system