KEGG   Ralstonia pickettii 12D: Rpic12D_4744
Entry
Rpic12D_4744      CDS       T00925                                 

Definition
(GenBank) type II secretion system protein E
  KO
K02283  pilus assembly protein CpaF [EC:7.4.2.8]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_4744
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_4744
Enzymes [BR:rpf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Rpic12D_4744
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_4744
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_4744
SSDB
Motif
Pfam: T2SSE IIGP Dynamin_N ABC_tran DUF87 FtsK_SpoIIIE AAA_22 AAA_25 MMR_HSR1 AAA_33 Pox_A32 AAA_24 TrwB_AAD_bind AAA_16 AAA_7 Zeta_toxin Septin TsaE
Other DBs
NCBI-ProteinID: ACS65979
UniProt: C6BQD2
Position
pRp12D01:88937..89986
AA seq 349 aa
MSDPIGDAKSRRELSVLAKVRNCLTTLQEWFDDQSVTDIMINRPDDVWVQQGGRQFSTGA
KISASQIEAAITLLASNSGITVSNESADAIVSTKLPGFRVEATLPPVAVDGPTICFRRNN
MVVMAMEDWIKQGALPPEIAEFLVDVVRKRLGVAVVGSTGSGKTTFANTLLGCFPEGDRI
ITIEQVPELVLKAPNSVRLQINPQLKVTAKRLLESVLRQNPNRIVLGEARGAEANDLLQS
ANTGHPGPLVTLHANNGKEGLTRFEDMVAQSSDAPDSREGIQVRIASAFQVMVFMTLVGD
DRIVAEVVSVDGFNRQTKEYETKLIYRSSRYETFDVPLVGIQRDLAEAA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagcgatccaataggggacgcgaagagcaggagggaactaagcgtcttggcgaaggtt
cggaactgcttgacgactctgcaggagtggtttgatgaccaatcggtgacggacatcatg
atcaaccggccggatgacgtatgggtccagcagggtggcagacagttcagcaccggcgcc
aagattagcgctagccagattgaggccgcaattacgctgctggcttccaactctggaatc
accgtcagcaatgaatctgctgacgcaatcgtcagcaccaagctgccaggattccgcgta
gaggcaacgctgccaccggtggcggtcgatggcccgaccatttgtttccggcgaaacaac
atggtggtcatggcgatggaagattggatcaaacaaggtgctcttcctccggagattgcc
gagtttctcgtggacgttgtccgaaagcgtctcggagtcgcggttgtcggaagtaccgga
tctggaaagacaacgttcgccaatacgttgctcgggtgcttcccggaaggtgaccgaatt
atcacgatcgagcaggtgccggaattggtgctcaaggctccaaacagtgtgcgcttgcag
atcaatccgcagctcaaggttacggcgaagcggctgcttgaaagtgtgctgcgacagaac
cccaaccgcatcgtgctcggggaagctcgtggtgcagaagcaaacgatctgctccagtca
gcgaacaccggccacccgggcccgcttgtcaccttgcacgcaaacaacggcaaggaaggg
ttgacgcgattcgaggacatggttgcgcaatcgagcgacgcacctgatagccgcgagggc
attcaagtacgaatcgcttctgccttccaggtgatggtcttcatgacactggttggcgac
gaccggattgtcgctgaagtagtgagtgtcgatggctttaaccgccaaacgaaagagtac
gaaaccaagctgatctataggagcagtcgatatgaaacttttgatgtcccacttgtcggt
attcaacgcgatctcgcagaagcagcgtaa

DBGET integrated database retrieval system