KEGG   Saccharomyces cerevisiae (budding yeast): YKL209C
Entry
YKL209C           CDS       T00005                                 

Gene name
STE6
Definition
(RefSeq) ATP-binding cassette A-factor transporter STE6
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YKL209C (STE6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YKL209C (STE6)
   04147 Exosome [BR:sce04147]
    YKL209C (STE6)
   04090 CD molecules [BR:sce04090]
    YKL209C (STE6)
Enzymes [BR:sce01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     YKL209C (STE6)
Transporters [BR:sce02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    YKL209C (STE6)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YKL209C (STE6)
CD molecules [BR:sce04090]
 Proteins
  YKL209C (STE6)
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 RsgA_GTPase AAA_29 ABC_ATPase AAA_16 AAA_15 AAA_5 MMR_HSR1 AAA_24 AAA_18 DUF87 AAA_23 P4Ha_N DUF3987 Zeta_toxin Rce1-like AAA_21
Other DBs
NCBI-GeneID: 853671
NCBI-ProteinID: NP_012713
SGD: S000001692
UniProt: P12866
Position
XI:complement(42423..46295)
AA seq 1290 aa
MNFLSFKTTKHYHIFRYVNIRNDYRLLMIMIIGTVATGLVPAITSILTGRVFDLLSVFVA
NGSHQGLYSQLVQRSMAVMALGAASVPVMWLSLTSWMHIGERQGFRIRSQILEAYLEEKP
MEWYDNNEKLLGDFTQINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLII
LCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKFK
EIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSC
IMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYATSDLTFA
NVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISING
HNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQ
MALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVH
RNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLADPTTTFST
WYHLQNDYSDAKTIVDTETEEKSIHTVESFNSQLETPKLGSCLSNLGYDETDQLSFYEAI
YQKRSNVRTRRVKVEEENIGYALKQQKNTESSTGPQLLSIIQIIKRMIKSIRYKKILILG
LLCSLIAGATNPVFSYTFSFLLEGIVPSTDGKTGSSHYLAKWSLLVLGVAAADGIFNFAK
GFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLVSEFL
SAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQL
ENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIVMCIQ
AIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIYRILD
EKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCG
QTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLF
NGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDTTLLSGGQAQRLCI
ARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVL
KDGKVVERGNFDTLYNNRGELFQIVSNQSS
NT seq 3873 nt   +upstreamnt  +downstreamnt
atgaactttttaagttttaagactacaaaacactatcacattttcaggtacgtgaacata
cggaatgactacaggctgttaatgataatgataataggtaccgtggcaacaggcctagtg
ccggcaattacttctatcctgacgggcagagtgttcgatctactatcagttttcgtggct
aatgggtcacatcaaggtttgtattcccaactagtacagaggtcaatggcagtaatggca
cttggtgcggcttctgtgccagtaatgtggctttctctaacaagttggatgcacatcggc
gagagacaaggctttagaatacggtcacagatattggaggcatatttggaggaaaagcca
atggaatggtacgacaataatgaaaaattgttaggagattttactcaaatcaacagatgt
gtggaagagctaagatcaagctccgcagaggcatcagccataactttccagaatttagtt
gcaatatgtgcgcttctggggacgtcattctactattcttggtcattaactttaattatt
ctttgcagctctccaataatcacattttttgcagtggtgttttccagaatgattcatgta
tattcagagaaggagaattctgaaacgagtaaagcagcccaattacttacatggtcgatg
aatgccgctcaattagtgagattatattgtacacaacgtctagaaaggaaaaaattcaag
gaaatcatactaaattgtaacactttcttcatcaagagttgcttttttgttgctgcaaac
gctgggatcttgagatttttgacgttgactatgtttgtacagggattctggtttggttcc
gcaatgatcaaaaagggcaagctgaacattaacgatgtaatcacttgcttccattcatgc
attatgctgggctcgactttaaataatacattacaccaaatagttgttcttcaaaaaggc
ggagtggctatggaaaaaatcatgactctattaaaagatggatccaagcgaaatccttta
aataaaactgtagcccaccaatttccactagattatgccaccagtgatctaacatttgct
aatgtttcgttttcttatccaagcagaccttcggaagcagttttaaagaacgttagttta
aatttctctgcaggacaatttactttcatagtaggaaaatcaggctcaggtaaatctaca
ttatccaacttattattaaggttctacgatggctataatggatcgatatctatcaatggc
cacaatatccaaacaatcgaccaaaaattgctaattgaaaatatcaccgtcgtagaacag
cgttgtaccctatttaatgatactcttagaaaaaatattcttttaggttcaacagattcg
gtaagaaatgccgattgcagcaccaatgaaaatagacatttaatcaaagatgcctgtcaa
atggctcttctggatagatttattctagaccttcccgatggactggaaacattaattggg
actgggggtgtcacactaagtggcgggcaacaacaaagagttgctatagcacgtgcattc
atcagagatactccaatattattcttagacgaagctgtatcggctctagatattgttcat
cgcaacctgttgatgaaggcaattaggcattggaggaaaggaaagactacaatcatattg
acgcatgagttgagccaaattgaatctgatgactatttatatttaatgaaggaaggtgaa
gttgttgaaagcggcacccagtctgaacttctagccgatccgaccactacatttagcaca
tggtatcacctacagaatgactactctgatgcgaaaactattgtagatacagagactgaa
gaaaaatctatacacactgtggaaagttttaactctcaattggaaacaccaaaacttgga
tcatgcttaagtaatctgggatatgatgagacagatcagttgtccttttacgaagcaatc
tatcaaaaaagatcgaacgttagaacaagaagggttaaagttgaagaggaaaatattggg
tatgcactaaaacaacaaaagaacaccgaaagttcaacagggccacaacttctgagcatt
attcagattatcaaaagaatgattaaaagcataagatacaaaaaaattctaatcttggga
ctgctatgttctcttatcgcaggcgccacaaatcccgtcttttcatacacattcagtttc
ttactagaaggaattgtcccatccacggatggaaaaactggctcttcacattatttggcg
aaatggtcgcttcttgttcttggtgtggctgcggcagatggtattttcaattttgctaaa
ggattcctattagattgctgcagtgaatactgggttatggatcttagaaatgaagttatg
gaaaaactgacgagaaagaatatggactggttttctggtgaaaacaacaaggcttctgaa
atttctgctctagtcttgaatgatttgcgagatttgaggtctttggtctctgaatttttg
agtgcaatgactagtttcgttaccgtatcaacgattggactaatttgggcgttagtatcg
ggctggaagttaagtttggtttgtatttcgatgtttccactcataattatattttcagca
atatatggaggcattttacaaaaatgcgaaacagattataagacatctgttgctcagtta
gaaaactgcctgtaccagattgtcactaacattaaaaccattaagtgcttacaagctgaa
tttcattttcaattgacctaccatgacttgaagataaaaatgcaacaaattgcctccaaa
cgcgccattgccacaggatttggtatatctatgacaaacatgattgtcatgtgtatccaa
gctattatttactactatggcctaaagctggttatgattcacgagtacacctcaaaggaa
atgtttacgactttcactttgttattattcactattatgtcatgcactagcctagtaagt
cagatacccgatataagtagaggccaacgtgctgccagttggatctataggattcttgat
gaaaagcataataccctagaggttgaaaacaataatgctagaacagtgggaatagctggt
cacacctaccatggcaaagaaaaaaaaccaatcgtttcaattcaaaatttgacatttgcc
tatccatctgcacctaccgcctttgtttacaaaaacatgaattttgacatgttttgcgga
cagacgttaggtatcattggtgaatcaggcacaggaaagtctacacttgtgcttttatta
acaaaactttataattgtgaagtaggcaaaattaaaatagacggtacggacgtaaatgac
tggaatttgacaagtttaagaaaagaaatttcagtggttgagcaaaaacctttattattc
aatggaaccatcagagataacctaacttatggtttacaagatgaaatacttgaaattgaa
atgtatgatgcattaaaatacgtaggaatccatgactttgtaatttcatcacctcagggc
ttggatacacgtattgatacaactttactgtcaggtggacaagcgcaaaggctttgcata
gccagagcacttctgagaaaatcaaaaattctgattttagatgagtgtacttcagccttg
gattctgtcagctcctctatcatcaatgagatcgtcaaaaaaggtccacctgctctacta
acaatggttataacgcatagtgaacaaatgatgaggtcttgtaactcgattgcagttctt
aaagatggtaaagtggttgagcgaggtaacttcgacactttatataataatcgcggggaa
ttattccaaattgtttccaaccaaagcagttaa

DBGET integrated database retrieval system