KEGG   Saccharomyces cerevisiae (budding yeast): YLR403WHelp
Entry
YLR403W           CDS       T00005                                 

Gene name
SFP1
Definition
(RefSeq) zinc-coordinating transcription factor SFP1
  KO
K19487  transcription factor SFP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YLR403W (SFP1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Others
    YLR403W (SFP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C2H2_aberr zf-C2H2_4 zf-C2H2 zf-H2C2_2 PBP1_TM
Motif
Other DBs
NCBI-GeneID: 851119
NCBI-ProteinID: NP_013507
SGD: S000004395
UniProt: P32432
Position
XII:925568..927619
Genome map
AA seq 683 aa AA seqDB search
MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNT
DFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSI
SVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGY
SISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMN
SAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANL
QSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVI
SITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGI
NINNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLV
QDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDD
DDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKC
PVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYR
CEVCGKRYKNLNGLKYHRGHSTH
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggattttacaacaatgactatggcaagcaatatggctactagtactactacgacggct
acatcggcacatgcatctataaattcgtcatcaaactttaatattgatattgattcgaac
cagaatactccttccattttgataaataacaattcggattcttctaatggaaaaaacaca
gattttaacggcgtcaataatattcaccaaaaaaatatcatgaataatacaaataatgtt
catttgtactctccaaatataatggaccaaacgctactaactccacaggacattgccaag
ttacggagagaatcaatagcccattctcaagggatgggtggtgtttcatggggatccatt
agtgttggttcttggttaagagatgaaattattagccgtagaaatagtattgtacctgca
tcagcaaacggtgctgcctccgctgccgcttctgcaaccactactgccactaatactttg
cagattcaacaaccaactaagagaccctctgttagtaatccgccttaccatagagggtat
tctatttctcctcagatagcctacactgcttatctgccaaatctagaaaagcaatattgt
aaagattattcatgctgtggtctttccttaccaggtttgcatgatttgctgagacattac
gaagaagctcatatatccacgtctcctaacactaccaatatgtcacaaataccgatgaac
tctgctggtaacactagttcatcagttcgtatgacaaataatacctcttctgccaactat
aacctgcagaataacatggccgctaatacaaaaaatgcaggtcataagactaatactatg
caggctcatagcagcaatgcaactaataacacctccattaataatatgcatgccaatctt
cagagcaacatggattccaactccacaatacgacaatctcagcatcctcaccatcagcag
aatataatacaacaacagttgcaatcgaattctgtaaatcatacatcaggggctgtaccc
acaccgagtgtaatgggttcagcaactgcgtcgtccacaactgcaaatccaaatgtgata
tctataacgggtgcccccaactcgggcttatctatggctaatcactctcaacaactacat
ctgaatggtaatctagtcgatgccgtttcaacgaatgatgtgtttttaagaacgagcaat
tctccatcaagacacgttccgcacaataaacaaattaacagtaacaataatagtggtatc
aatatcaataataatacctcacacaattctaatattaacatgggtagtaaaaacgccatg
gtgaatcgtccacatacttttaataactattccttgaacaaaacgtccaggaatcctatt
caacatcaatcaagaaaaattgatcctcatcaaaccgatttatcacctctggtacttgtc
caagatatagatttaagttttatggatgatgatattttgggccctagtaaccacaattcc
atgaactctgtcgtaaatccaactacaggttctcacaactacaatacttttcattcttcc
gtacacgcaaaatcttctcaaaacatggtcgaggatcaagacattgatgacattgatgat
gacgatgatgttgatgatgacgatgacgatgacgatgacgatgacacagaaaatggctcc
agttccaatggaaaatcagttcataacaacaattacaagatgcctcagcaagcttatata
gacgatcctgcgagaaggctctatgtaatggatcatgaggaacaaaaaccctttaagtgt
ccagttattggttgtgaaaagacttataaaaaccaaaacggtttgaagtaccataggttg
cacggacatcagaatcaaaaattacatgaaaaccctgacggtacatttagcgtaatagat
ccagattcgacagattcttttggtgatggaatgggctctgcaaaggataaaccataccgt
tgtgaagtttgtggtaagagatataagaacttgaacggtttaaaatatcacaggggccac
tccactcactaa

DBGET integrated database retrieval system