KEGG   Saccharomyces cerevisiae (budding yeast): YOR022C
Entry
YOR022C           CDS       T00005                                 

Gene name
DDL1
Definition
(RefSeq) putative carboxylic ester hydrolase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: DDHD LCAT WWE LIDHydrolase TrbL_3 YTV
Other DBs
NCBI-GeneID: 854187
NCBI-ProteinID: NP_014665
SGD: S000005548
UniProt: Q12204
Position
XV:complement(373710..375857)
AA seq 715 aa
MLRFTHRGLPSSTRFRNIFVRLNHIYVPWFYAIDVPNSKPYLPTYQTLHSPKKFKPFSVD
DSNRLEKASKRQERRPVLVNEDYLFKVDLSHMELSPTYWEGPTYQVRRGVWFDSSNQPLS
SDLTSEIEGLYKQLKFDDSNDDPTTTPPAESQDIFRLKGKYPVDKENEGEQKNGSSNKDE
NESTFKFILFANKQTAFLLSDLDGGKLQLAFLRSNLAQSLPINATMITRSYKYSSSATTK
QTSTSFKAAKTPQTEVADGSNSSKSRSIETKLEKKVSNLFNLSDFLQLFNGNASKDQDDA
QSLEKQMETDYNNADNSQGANASSKIEDGKNSGASDRQIRSNRRDVDNLILCVHGIGQTL
GKKYEYVNFAHTVNLLRSNMKKIYNNSEKLQSLNTAPDYKSNCNVQVLPITWRHSISFQT
DAKEENIENPDLPTLSQVTVNGVLPLRKLLADGLLDILLYVEPYYQDMILQQVTSQLNKT
YRIFKEFNPEFDGKVHLVGHSLGSMILFDILSKQKKYELEFQVDNLFFIGSPIGLLKLIQ
RTKIGDRPEFPNDLERKLTVQRPQCKDIYNVYHVCDPISYRMEPLVSKEMAHYEQTYLPH
CSEAYGLTSKVLEFGENIWKDLPGTDENNLQSKKTSPEKKEVKLSENLTRMLTGLNYTGR
LDYAMSPSLLEVDFISAIKSHVSYFEEPDIAAFILKEILSKHENASEIYVKRKTG
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgctacggtttactcatcgaggccttccctccagcactcgttttagaaacattttcgta
aggttaaatcacatttatgtaccatggttctatgccatagacgtacccaactccaaaccc
tatttacccacatatcaaactttacactcacccaaaaagtttaagccgttctccgttgat
gattctaatcgtttggaaaaggccagtaagcgtcaagaacgcaggcctgttttagtcaac
gaagattacctgtttaaagtcgacctctctcacatggaattgtcccctacctattgggaa
ggccctacttatcaagtacgaagaggtgtgtggttcgactcttcaaatcaacctttgtcc
agtgatcttacctccgaaattgaagggttgtataagcagctcaaattcgacgacagtaat
gatgatccgaccacgacacctcctgcagaatcgcaagatatatttaggctcaaaggtaaa
tacccagtcgataaagaaaacgaaggagagcaaaaaaatggatccagcaataaagatgag
aacgaatctactttcaagtttattttgtttgccaataaacaaactgcatttttactatcg
gatttagatggaggaaaactgcaattagcctttctaaggtctaatctggctcaatcctta
ccgattaatgctacaatgattacaagatcatacaaatattcatcctccgcaactactaaa
cagacatccacatcttttaaggcagcaaaaacgcctcaaacggaagtagcagatggtagt
aacagttccaaatcgaggagcattgaaacaaagttagaaaagaaagtttcaaacctcttc
aatttatcggactttttacagttgttcaatggtaatgctagtaaagatcaagatgatgca
cagagcttggaaaagcaaatggaaacagactataacaatgcagataacagtcaaggcgct
aatgctagtagcaaaatagaagatggcaaaaattcgggcgcaagcgatagacaaattaga
agtaacagaagagatgtggataacttgatactatgcgttcacggtataggtcagactttg
ggtaagaagtacgaatacgtaaatttcgcacacacggtaaatctacttaggtctaatatg
aaaaaaatctacaataattctgagaaactacaatcattaaacacagcacctgattataaa
agcaactgtaacgttcaagtgctacccatcacctggaggcactcgataagtttccaaacg
gatgctaaggaggaaaatatagaaaatcctgacctaccgactttgtcacaagtcacagta
aatggagtgttacccttgaggaagctactggctgacggtctactagatattttgttgtat
gtcgaaccatactaccaagatatgattctacaacaagtaacctctcaattgaacaaaaca
tatcggatttttaaagaatttaatccagagtttgatgggaaagtccatttagtgggccat
tcgttgggtagtatgatattatttgatattctatccaaacaaaaaaaatatgaattagaa
tttcaagtagacaacctgttctttattggctcaccaattggattgttaaagttaattcaa
agaacaaaaattggtgaccgtcccgaatttcccaatgacttggagagaaaattaaccgta
cagagaccgcaatgtaaggacatttataatgtttaccacgtctgtgatcccatttcttat
aggatggaacctcttgttagtaaagaaatggctcattacgaacaaacttatttaccacat
tgtagtgaagcttatggactaacttctaaagttttggaatttggcgaaaacatatggaaa
gatttgccaggtactgatgaaaataatttgcagtccaaaaaaacttctccagaaaaaaaa
gaggtcaagttatcagaaaatcttacgagaatgcttacaggtttgaattacaccggacgt
ctagattatgctatgtctccaagtctgctagaagtggattttatatcagctataaaatca
catgtttcttatttcgaagaaccggatattgcagcgtttatcctaaaagaaattttaagt
aaacatgaaaatgcatcagaaatatatgtaaaaagaaagactggttga

DBGET integrated database retrieval system