KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4427
Entry
SPC_4427          CDS       T00862                                 
Name
(GenBank) hypothetical protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG HerA_C DUF87 AAA_22 AAA_29 AAA_7 FtsK_SpoIIIE T2SSE ATPase_2
Other DBs
NCBI-ProteinID: ACN48480
UniProt: C0Q5D3
Position
4532850..4535687
AA seq 945 aa
MVSFSLFNKNRLKSSSPREPDELPESDFAVHGRDPLKRPGMMSHADESRLYETRPSIIDF
LPWAEYLSREQCLLLDDGQSVGAVYSISPVASEGRTAARLEEIRDSVEDALQDSLEEFDS
NPWVVQFFCQDETDFSAYMNRLASYIKPHAQRTAFTKAWLAETEQHLRNITRPEGLFTDS
LVTGVPWRGQNRSVRMVVYRYLPANYKDDSPVAALNQVCERLTSALSAAGVLSVRQNGEQ
IHRWLLRHFNPEPDWIDKDTLYREARYYDDAPDSLPLGNDFTETLWFNPPRSDTRNGVWW
FDNVAHRAVPVETLRRPPGPGHLTGEVKRGDNINTLMDLLPEGTMVSLTIVAQAQDTLEA
GFDTLGKNAIGQNTESRRTRSDVEQVKSLLGMRHKLYRASITFLMRAPDVSELNKKIQQL
TATLLTAGLQPTKPEYEVAPLNDYLRALPMCFNPQLDKKNWYTRLTWVQHLAGLLPVTGR
SQGTGHPGFSFFNRGGELLSFDPLNSLDRTQNAHLLLFGPTGAGKSATLCSALSQLMAVH
RPRLFIAEAGNSFGLLAEYFRGLGLSVNVLSIKPGCGISLPMFADAHSLMRVDPKKNVVS
EEALPELEPANTDSAEDESEERDILGEMEIAARMMITGGEKREEERLTRADRGLIREAIM
MAAEKTYQDGHQMLAEDLQAALWNISRDNSIGANGEPMRNQSRRDRAAEMAEAMAMFTQG
FEGELFNRPGTPWPEADVTLIDLGHLAREGYGAQMALAMVSLINTINNIAERDQGTARDI
VAVFDEAHISTTNPLLSPYMTKVVKMWRKLGAWLWLATQNLEDFPDIAQKMLNMAEWWLC
LVMPPDEVEQIARFKTLSEEQKVILRSASKLKNCYTEGVVLSKQVEALFRVVPPSLYLSL
GMTEKEEKAERQRLMREYQCSELEAAIRVARRLDEARGFCPQKAA
NT seq 2838 nt   +upstreamnt  +downstreamnt
atggtcagtttttctttgtttaacaaaaacaggctgaagtcatcttctccccgggagcct
gacgagttaccggaaagtgactttgctgttcatggccgtgacccactgaaacgcccgggc
atgatgagtcacgctgatgaatcccgtttatacgaaacccgtccgtccattattgatttt
ttgccctgggccgagtacctgagtcgcgagcaatgtctgctgcttgacgatggccagtct
gtcggtgcggtatacagtatatcgccagtggcatcagaggggcgcacagctgcccgtctg
gaagaaataagggattcggttgaagatgcacttcaggacagccttgaagagtttgattct
aacccatgggtagtacagtttttttgtcaggatgaaactgacttcagtgcctatatgaat
cggttagccagttacatcaaaccgcatgctcagaggacggcatttacgaaggcctggctg
gctgaaacagaacagcatctgcgaaatatcacccggccggaaggtttgttcactgattca
cttgtcaccggggttccctggcggggacaaaatcgttccgtcaggatggtggtatatcga
tacctgccagcgaattacaaagatgattcgccggttgccgctctcaaccaggtttgtgag
cgcctgacttcagccttatctgcagccggcgttctgagtgtccgacagaatggcgagcag
atacatcgatggttgttacgtcacttcaatcctgagcccgactggatagacaaagatacg
ctttaccgggaggctcgttattatgatgatgcacctgattcattgcctcttggcaatgat
ttcactgagacgttgtggtttaaccctccacgttctgatacccgaaatggtgtgtggtgg
tttgataatgtggcgcatcgtgccgttcctgttgaaacattacgtcgccctccgggaccc
ggtcatctgacgggggaggttaagcgtggcgacaatattaatactctgatggatttattg
cctgagggcacaatggtatcgctcactattgtggcgcaggctcaggacacgctggaagcc
gggtttgacacgctgggtaaaaatgcaatagggcagaacacggaatccaggcggacccgt
agtgatgtggagcaggtgaagagtttgctgggcatgcgtcacaaactttatcgtgcatcg
ataacttttttgatgcgtgcacctgatgtcagtgagctgaataaaaaaatacagcaactt
accgctacattgctgactgcggggctccagcccacgaaacctgaatacgaagtggcgccc
ctgaatgactatttgcgagcgcttcctatgtgttttaacccgcaactggataaaaaaaac
tggtatacccgcctgacctgggttcagcatctggctggattgcttcccgtgaccggtcgc
agccagggaaccggacaccccgggtttagtttttttaaccgtggcggagaactgttgtct
tttgatcccttaaatagtctggacagaacgcagaatgctcacctgttgctttttggtccg
accggggcgggtaaatcagccaccttatgtagtgcgttatcacagttaatggccgttcat
cgtccacgcctctttattgccgaagccggcaacagttttggtttgctggcggagtatttc
cgggggctgggactgagcgtaaatgtactgagtatcaaacctggctgcggtatttcttta
ccgatgtttgctgatgctcattccttaatgcgagtagatccaaagaaaaacgtggtttct
gaggaagctctacctgagctggagccagccaataccgacagcgcagaagatgaaagtgaa
gagcgtgacattcttggcgaaatggaaattgcagcccggatgatgatcaccggtggcgag
aagcgggaggaggaacgtcttacccgggctgaccgcggtcttattcgtgaagctatcatg
atggcggcggagaaaacatatcaggacggacatcagatgctggctgaggatttacaggct
gccctgtggaatatctcacgtgataattccattggtgcaaatggcgagcctatgcggaat
cagtcccgtcgcgatcgtgctgctgagatggcagaagccatggccatgttcactcaggga
tttgagggagagttattcaaccgtccgggaacaccatggccagaggctgatgtcacactg
atcgatttaggtcatctggcacgtgaaggctatggtgcacaaatggcgctggcgatggtc
tctttaattaacacgattaacaatatcgccgaacgtgaccagggaacagcccgggatatt
gtggccgtatttgatgaagcccatatttccacgacgaatcctttgttgtcgccctatatg
accaaggttgtgaaaatgtggcgaaaactgggggcatggctgtggctggcgacacagaac
ctcgaggattttcctgatattgcgcagaaaatgctgaacatggctgaatggtggttgtgc
ctggttatgcctcccgatgaggtggagcagattgcccgtttcaaaaccctcagcgaggag
caaaaagttattttgcgatcagccagtaagctcaaaaactgttataccgagggcgtcgtt
ttatcaaagcaggttgaggcactgttccgggttgtgcctcccagtctgtatctctccctg
gggatgactgaaaaagaggaaaaagcggaacgtcagcggctgatgcgagagtatcagtgc
agtgagcttgaggcagcgatccgggtggcccgcaggctggatgaggcacggggtttttgt
ccacaaaaagcggcctga

DBGET integrated database retrieval system