KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2023
Entry
SPUL_2023         CDS       T01740                                 

Gene name
msbA
Definition
(GenBank) putative transport ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPUL_2023 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_2023 (msbA)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SPUL_2023 (msbA)
Transporters [BR:sel02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    SPUL_2023 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 DEAD AAA_22 Zeta_toxin DUF87 Cytidylate_kin AAA_29 DUF2075 AAA_24 AAA_18 AAA_25 APS_kinase AAA_15 RsgA_GTPase AAA_30 ABC_membrane_2 NB-ARC MMR_HSR1
Other DBs
NCBI-ProteinID: AET54349
Structure
PDB: 
6BL6 3B60 3B5Z 6O30 3B5Y

Position
complement(2019896..2021644)
AA seq 582 aa
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD
RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS
TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI
AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR
NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA
LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL
LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcataacgataaagatctctctacgtggcagaccttccgccgactgtggccaaccata
gcgccttttaaagcaggtctgatcgtggcgggcatagcgttaattctcaacgcagccagc
gataccttcatgctatcgctcctcaagccattactggatgatggtttcggtaaaacggat
cgctcagtgttgctgtggatgccgctggtggttattgggctgatgatattacgaggcatc
actagctatatctccagctactgtatttcatgggtgtcaggcaaggtggtaatgaccatg
cgccgtcgcctgtttggccatatgatgggaatgcccgtcgccttctttgataaacagtct
accggtacgctgctgtcgcgtattacttacgattcagaacaggttgcctcttcttcatct
ggcgcactgattaccgtggtgcgtgaaggggcatcgatcatcggattgtttatcatgatg
ttctattacagctggcagttgtcgatcatcctggttgttttagcaccgattgtgtcgatt
gcgattcgcgttgtctcaaagcggttccgcagcatcagtaaaaatatgcagaacacgatg
ggacaagtgactaccagcgctgaacaaatgctgaaaggacacaaagaggtactgattttt
ggcggtcaggaagtcgaaactaaacgctttgataaagtcagcaataagatgcgactgcaa
ggcatgaaaatggtctctgcctcgtcaatttccgatcctatcattcagctcattgcctcg
ctggcgctggcgtttgtcctctatgctgcgagcttcccaagcgtaatggatagcctgacg
gcagggaccatcaccgtggtgttctcctccatgatcgcgctgatgcgtccattaaaatcg
ctgacaaacgttaacgcgcagttccagcgtgggatggcggcttgtcaaacgttgtttgcg
attctggatagcgaacaggagaaagatgaaggtaaacgtgtcattgaccgcgcgaccggc
gatctcgaattccgcaatgtgacgtttacttacccgggccgtgaagtgccggcattgcgt
aacatcaatttgaaaattcctgccgggaaaaccgtggcgctggtggggcgttccggatcg
ggtaaatcaactatcgccagtctgatcacccgtttctacgatattgatgaagggcacatc
ctgatggatggtcacgatctacgcgaatacactctggcctctctacgtaatcaggtggcg
ctggtttcgcaaaacgtgcatctgtttaacgacacggtcgccaataacattgcttatgcc
cggacggaagaatacagccgcgagcagattgaagaggcggcgcgcatggcctatgccatg
gactttatcaataagatggataatggcctggataccatcatcggcgaaaacggcgtactg
ctttccggcggtcagcgccagcgtatcgcgatcgcccgcgccttactgcgcgacagcccg
attctgatccttgatgaagctacgtccgcgctggataccgaatctgaacgtgcgattcag
gcagcgttggatgagctgcagaaaaaccgtacctctctggtgattgcgcaccgtctctcc
accatcgaacaggcggatgagatcgttgtagtcgaagacggtattatcgttgagcgcggc
actcatagcgagctgctggcgcaacacggcgtttacgcccagctacataagatgcaattt
ggccaatga

DBGET integrated database retrieval system