KEGG   Streptococcus gallolyticus UCN34: GALLO_1654
Entry
GALLO_1654        CDS       T01171                                 
Name
(GenBank) putative conjugative transposon protein
Organism
sga  Streptococcus gallolyticus UCN34
SSDB
Motif
Pfam: AAA_10 DUF87 nSTAND3 Methyltransf_32 FtsK_SpoIIIE DEAD ABC_tran ResIII AAA_22 Zeta_toxin SLFN-g3_helicase HerA_C T2SSE AAA_14 AAA_16 Sigma54_activat AAA_5
Other DBs
NCBI-ProteinID: CBI14145
UniProt: A0AA36JYW6
Position
complement(1746272..1748773)
AA seq 833 aa
MVKRLEYPIAKTDGNMALRKDGVVTAFYRVPNTPITITDTDKKKKHKITVSQVVKKLAKY
KYFEVSLIPRDYLLEEKMRDFSDDLADDSKVLGEQTLSKTVGLLTKEMEIPYEYEWIVGI
NIEKTIVKNNLTEAVTNQLSEIAENIAGFLGFEVETLENWYEDYQEIESIIYRLLSPLKA
KRLTNEELFYYQRYQFLTYIPHLREDVIANRALENVTDTVITVVEEGILKLSSIYGTSYL
SILPIGRYSTIFNGFHLGELLQRLSFPVWLKMKAEFIDKSGLNGQMGRSNNRYRNIMNEA
ASTDTVQQDDILMGAYSLKDLMKKVGNKEELIRFGAYVTVAASNIKQLKQRRQSLLSYFQ
DMSVSLHEAGHDTPYLFQSLLYGQDLQVTTRKWNHLVTCKGFAELMLFTNTRSGNRIGWY
IGRVDNRLTAWDNIDEAVQGSKNLVLFNATVANKEDIAGKVTKNPHLIITGATGNGKSYL
AQLLFLLTSQQNVRILYIDPKRELREHYQKVISQPDFARRFPERKKQIENINFVTLDATL
ESNHGVLDPIVILEKENAQATAKNMLLYLLRQATQVELTQTTSLTNAITTVLERREAGET
VGFNHVIELLCQDVDKKVVEVGEYFKAIIRNSILELAFSDGNVKGLSYDERVTVLEIADL
SLPKDGVEDISDHEANSICLMFALGAFCKHFGERNDDETLEIFDEAWILMQSSEGKAVIK
SMRRVGRSKYNTLCLVTQSVHDAENEEDSTGFGTIFAFYEKSERKDILKHVGLEVTEKNL
EWLDNMISGQCLYYDVYGNLNMISVHNLFEDIDPFLKPMKQTTSSVLENKYAS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggtaaagcgtttggaatatccgatagcaaagactgatggaaatatggctttacgtaag
gacggtgttgtcacggctttttatcgagttccgaacacaccaattacaattacagatacg
gataaaaagaaaaaacataagataacagtttcacaggtggttaagaagctagcaaaatat
aaatattttgaagtttctttgattcccagggactatctattagaagaaaaaatgcgagat
ttttcagatgatttagctgatgattcaaaagtattaggtgaacaaacacttagtaaaact
gttggactattgactaaagagatggaaattccttatgagtatgaatggatagtcggtatt
aatattgaaaaaacgatagttaaaaataatttaactgaagctgttacgaatcaattatca
gaaatagcggaaaatattgctggctttttaggttttgaagttgagaccttagagaattgg
tatgaagattatcaagagattgaatccattatctatcgcctactatcaccgttaaaagca
aaacgattaacaaatgaagaattgttctattatcaacggtatcagttcttaacttatatt
cctcatttgagggaagatgtgattgccaatcgtgctttggaaaatgtgacagatactgtg
attaccgttgttgaagagggaattttaaaactatctagtatttacggtacttcttacctt
tctattttgccaattggtcggtattcaacgatttttaatggttttcatttaggtgagttg
cttcaacgattaagttttcctgtttggttgaaaatgaaagcagagtttattgataagtct
ggtttaaacggtcaaatggggcggtcgaataatcgttatcgtaacattatgaatgaagcg
gctagtacggatacggtacagcaagatgatattttaatgggtgcttattcgttgaaagat
ttaatgaaaaaagttggtaacaaggaagaattgatacgttttggagcgtatgtgacggtg
gctgcttcaaacattaaacagttgaaacaacgtcgtcaatcgttactttcttacttccaa
gatatgagtgttagtttgcatgaggcaggtcatgatacgccttatcttttccaaagtttg
ctttacggtcaagatttgcaagttactactcgcaaatggaatcatttagttacttgtaaa
ggctttgcggagttaatgttgtttacaaatacacgttcaggtaaccgtattggttggtat
attggacgagtagataatcggctgactgcttgggataatattgatgaagcggttcaaggt
tctaagaacttagttctctttaatgcgaccgtcgcaaataaagaggatattgctggtaaa
gtaacgaaaaacccacacttgattatcacaggtgcaacaggtaatgggaagtcctatctt
gcccaattacttttcttgttgacaagccaacaaaatgtgagaattttgtacattgaccca
aaacgtgaactccgtgagcattatcaaaaggtgattagtcaacctgattttgcaagacgt
tttccagaacgtaaaaaacaaattgagaatatcaattttgtgacccttgacgctaccctt
gaatcgaatcatggggtacttgacccaattgtgattttggaaaaagaaaatgcgcaagca
acagctaaaaatatgttgctttacttgttacgtcaagcgacacaggttgaactcactcaa
acaacgtcgttgacaaatgcgattacaacggttttagaacgacgtgaagctggcgaaaca
gttggctttaatcatgtgattgagctactttgtcaagacgttgataaaaaggttgttgaa
gttggtgagtattttaaagccattattcgtaattcaatcttagagttagccttttcagac
ggtaatgttaaagggctttcttatgatgaacgggtaactgttttagagattgcggatttg
tcattgccaaaagatggtgtggaagatatttcagaccatgaagcaaattcaatttgcttg
atgtttgcactaggtgcattttgtaaacattttggtgaacgtaatgatgatgaaacactt
gaaatttttgatgaagcatggattttaatgcaatcatcagagggaaaagcggttatcaag
tctatgcgccgtgtcggacggtctaaatataacacgctttgcttggttactcaatctgtt
catgacgctgaaaatgaagaagattctactggttttggaacaatctttgccttttacgaa
aaatcggaacgaaaagatattctgaaacatgtaggcttagaagtgactgaaaaaaatcta
gaatggctggataatatgatttcaggacaatgtctttattatgatgtttatggcaacttg
aacatgatttcagtccataatttgtttgaagatattgatccattcttaaaaccaatgaaa
caaacaacgtcaagtgtactagaaaataaatacgctagttag

DBGET integrated database retrieval system