KEGG   Streptomyces avermitilis: SAVERM_6830
Entry
SAVERM_6830       CDS       T00126                                 

Gene name
pdxS
Definition
(GenBank) putative pyridoxine biosynthesis protein (lyase)
  KO
K06215  pyridoxal 5'-phosphate synthase pdxS subunit [EC:4.3.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_6830 (pdxS)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     SAVERM_6830 (pdxS)
SSDB
Motif
Pfam: SOR_SNZ ThiG Dus His_biosynth IGPS NanE TetR_C_27 NMO
Other DBs
NCBI-ProteinID: BAC74541
NITE: SAV6830
UniProt: Q827U0
Position
8154087..8155001
AA seq 304 aa
MSSTLSVPAQAPETGTARVKRGMAEQLKGGVIMDVVTPEQAKIAEDAGAVAVMALERVPA
DIRKDGGVARMSDPDMIEGIISAVSIPVMAKSRIGHFVEAQVLQSLGVDYIDESEVLTPA
DEVNHSDKWAFTTPFVCGATNLGEALRRIAEGAAMIRSKGEAGTGNVVEAVRHLRQIKNE
IARLRGYDNNELYAAAKELRAPYEIVKEVAELGKLPVVLFSAGGVATPADAALMRQLGAE
GVFVGSGIFKSGDPAKRAAAIVKATTFYDDPKIIADASRNLGEAMVGINCDTLPEAERYA
NRGW
NT seq 915 nt   +upstreamnt  +downstreamnt
gtgtccagcacgctctccgtccccgcacaggcccccgagaccggcaccgcccgagtgaag
cgcggcatggccgagcagctcaagggcggcgtgatcatggacgttgtcacgcccgagcag
gcgaagatcgccgaggatgcgggcgccgtcgccgtcatggccctggagcgggtcccggcc
gacatccgcaaggacggcggcgtggcccgcatgtccgaccccgacatgatcgagggcatc
atcagcgcggtgtccatcccggtcatggccaagtcccgcatcggccacttcgtcgaggcc
caggtgctccagtccctcggcgtcgactacatcgacgagtccgaggtcctcaccccggcc
gacgaggtcaaccactccgacaagtgggcgttcaccacgccgttcgtgtgtggtgccacc
aacctcggtgaggccctgcgccgcatcgccgagggtgccgccatgatccgctccaagggc
gaggccggcaccggcaacgtcgtcgaggccgtgcgccacctgcgccagatcaagaacgag
atcgccaggctgcgcggctacgacaacaacgagctgtacgccgccgccaaggagctgcgc
gccccgtacgagatcgtcaaggaggtcgccgagctcggcaagctgccggtcgtgctgttc
tccgccggtggcgtcgccaccccggccgacgccgcgctgatgcgccagctcggtgccgag
ggcgtcttcgtcggctccggcatcttcaagtccggcgacccggccaagcgcgccgccgcc
atcgtgaaggccaccaccttctacgacgaccccaagatcatcgcggacgcgtcgcgcaac
ctgggcgaggccatggtcggcatcaactgcgacaccctccccgaggccgagcgctacgcc
aaccgcggctggtaa

KEGG   Streptomyces avermitilis: SAVERM_6831
Entry
SAVERM_6831       CDS       T00126                                 

Gene name
pdxT
Definition
(GenBank) putative pyridoxine biosynthesis protein (glutamine amidotransferase)
  KO
K08681  5'-phosphate synthase pdxT subunit [EC:4.3.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_6831 (pdxT)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     SAVERM_6831 (pdxT)
SSDB
Motif
Pfam: SNO GATase_3 Peptidase_S51 GATase DJ-1_PfpI
Other DBs
NCBI-ProteinID: BAC74542
NITE: SAV6831
UniProt: Q81ZV5
Position
8155015..8155620
AA seq 201 aa
MNTPVIGVLALQGDVREHLIALAAADAVAREVRRPEELAEVDGLVIPGGESTTISKLAHL
FGMMEPLRARVRGGMPVYGTCAGMIMLADKILDPRSGQETIGGIDMIVRRNAFGRQNESF
EATVDVKGVGGDPVEGVFIRAPWVESVGAEAEVLAEHGGHIVAVRQGNALATSFHPELTG
DHRVHGLFVDMVRANRTPESL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaacacccccgtgataggcgtcctggctctgcagggcgacgtacgggagcacctgatc
gccctggccgcggccgacgccgtggccagggaggtgaggcgccccgaggaactcgccgag
gtcgacggcctcgtcatacccggcggcgagtccaccaccatctccaagctggcccatctc
ttcggcatgatggaacccctccgcgcgcgcgtgcgcggcggcatgcccgtctacggcacc
tgcgccggcatgatcatgctcgccgacaagatcctcgacccgcgctcgggtcaggagacc
atcggcggcatcgacatgatcgtgcgccgcaacgccttcggacgtcagaacgagtccttc
gaggcgacggtcgacgtcaagggcgtcgggggcgatcctgtcgagggcgtcttcatccgc
gccccctgggtcgagtccgtgggtgccgaggccgaggtgctcgccgagcacggcggccac
atcgtcgccgtacgccagggcaacgcgctcgccacgtcgttccacccggaactgaccggc
gaccaccgcgtgcacggcctcttcgtcgacatggtgcgcgcgaaccggacaccggagtcc
ttgtag

DBGET integrated database retrieval system