KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12258
Entry
HMPREF0837_12258  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K20342  HTH-type transcriptional regulator, regulator for ComX
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:snc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_12258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_12258
Transcription factors [BR:snc03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    HMPREF0837_12258
SSDB
Motif
Pfam: ComR_TPR HTH_3 HTH_19
Other DBs
NCBI-ProteinID: ADI70486
UniProt: D6ZPE0
Position
complement(2066591..2067490)
AA seq 299 aa
MLIGQKIKEIRIEKGISRPDFCGDEQELTVRQLSRIESGASQPSLPKLDYIARRLGVPVY
SLMPDFSALPPAYLELKYQILREPIYGKEEEYDKKEACLEEIYKTYFDNLPKEEQLACEV
LQACLDTSRTRRPEYAELILEEHMPQIIEKEVYSTNDMLLIRLFFYQMLIRKDLAKFINQ
IEELMLFLLEQKKVTKLENFFIIRDTLISGMCCLEKVGVTDCFNDYLSCLQEIMDKTQDY
QKKPLVFMFLWKQALREERDFSLAESFYQSSKTFAQLIGDEFLVKKLTEEWQEDVKKYL
NT seq 900 nt   +upstreamnt  +downstreamnt
atgttaattggtcaaaaaattaaagagattcggatagaaaaaggaattagtcgtccagat
ttttgtggagatgagcaagaactgacagttcgtcaactgtcgcgaattgaaagtggagct
tcgcaaccgagtttgcccaagttagactatattgctcgccggctaggagttccagtttat
agccttatgccggatttttcagctcttcctcctgcttatttagaattgaaatatcagatt
ttacgtgaaccaatctatggtaaagaagaggagtacgataagaaggaagcgtgtttggaa
gagatttataaaacatactttgataatcttcctaaagaagaacaattagcatgtgaagta
ttgcaggcgtgtttggatacttctagaactagaaggcctgaatatgcagagttaatactt
gaggaacatatgcctcagatcatagaaaaagaagtttattcaacaaatgatatgttgttg
attcgtttgtttttttatcaaatgctcattagaaaagatcttgccaaatttataaatcaa
atcgaagagctaatgctctttcttttggaacagaaaaaggtaactaaattagaaaacttc
tttataattagagatactcttatttcaggaatgtgttgtcttgaaaaggtaggagtaact
gattgttttaatgattatctatcgtgtttacaagaaattatggataaaactcaagattat
caaaagaaacctcttgtatttatgtttttgtggaagcaagcattaagagaagaaagagat
tttagtttagctgaatcattttatcagtcttctaaaacatttgcgcagctaattggagat
gaatttctagtaaagaaattgacagaggaatggcaagaggatgtcaaaaaatatttataa

DBGET integrated database retrieval system