KEGG   Serratia proteamaculans: Spro_0326
Entry
Spro_0326         CDS       T00595                                 
Name
(GenBank) putative plasmid transfer protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 T4SS-DNA_transf
Other DBs
NCBI-ProteinID: ABV39436
UniProt: A8G8J6
Position
377644..379758
AA seq 704 aa
MSNRHVMEALLRPAVELNTAIVAGAAAAICFVAPWSVALAPSVSYVTAGGFAVLSAVRAR
QGLRVIRYRRNLRRLPRYVMTSAQIPVSRQRLFLGRGFRWQQKHTQRLMDTRRPEVEKYV
QPPQLYQMARRLELKTEYTLPWLSQLLRKDSPLNPVRPLPPVGGNPAIHGIEPDELDVSM
ALGERVGHSLVLGTTRVGKTRLAELLITQDIRRGDITIVFDPKGDADLLRRVWAEAHRAG
RGDELFIFHLGWPDISARYNAVGRFERVSEVAGRISGQLSGEGNSAAFREFAWRFVNIVA
RALVALGQRPDYTLITRYVNNISELYETYAKKVIETRMPALQQQIDNNLKVLTEEDVPRN
MQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLAPNYMDMNDPRPIFDWEQVIRKRGIVYVGLDALSDGVVASAVGNSMFADLVSV
AGHIYKHGMHGGLPTRADGRLPINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTES
DIEARIGSTAKAAQVTGNFNTLIMLRVRENRTAQLLTTQLPEVDAYTKTLVSGHADTADV
EKGQDFTSSTQDRVGTVKTPLLMPADVINLPKGQAFALLEGGQLWKIRMPLPSGDGDDEL
MPPNLEKIAEEMQRNYRTSESWWSASTVMPDAVIKGGLNVTSGE
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgagtaatcgccacgttatggaagcgttgctgcgcccggcagtcgaattgaatacagcg
attgtggccggcgccgcagccgccatttgttttgttgccccctggtcagtggcattggcg
ccgtcggtgagttatgtcactgccggcgggtttgcggtgctgtctgcggtacgggcacgt
cagggcctgcgggtgatccgttaccgccgtaatctgcgccgactgccgcggtatgtcatg
accagcgcacaaataccggttagccggcagcggctgttcctggggcggggttttcgctgg
cagcaaaagcacacccagcgtctgatggacacccgtcgtccagaggttgagaagtatgtt
cagccaccgcagctgtaccagatggcgcggcgcctggagcttaaaactgaatacaccctg
ccgtggttgtcccaactgctgcgcaaggattccccactcaacccggtacggccgctgccg
ccagtgggtggcaatccggcgatccacggcatcgaacctgacgagctcgatgtttcgatg
gccttaggcgaacgtgttggccacagcctggtgttgggtactacgcgtgttggcaaaacg
cgcctcgccgagttgctgatcactcaggatattcgccgcggagacatcactattgtattt
gatccaaaaggcgatgcggacttgctgcggcgtgtctgggctgaagcccaccgtgccggc
cggggggatgagctgttcatcttccatctgggttggccggatatctctgcacgctataac
gccgtcggtcgctttgaacgggtatcggaagtcgctggccgtatctccgggcagttgagt
ggggagggcaacagtgcggcattccgcgagtttgcctggcgattcgtcaacatcgtcgca
cgagccctggtcgcgttggggcagcgaccggactacaccctcatcacccgctatgtgaac
aacatcagcgaactgtatgagacctacgcgaaaaaggtgattgaaacgcgtatgccggca
ctgcagcagcagatagataacaacctgaaggtgctgacggaggaggacgtgccgcgcaac
atgcagggacaaccgaacgcggtcaaaatattcgctgttgaaatggccctgagctcggaa
gctggcaagcagctgtacgaccctatcctggatggcttgcgctcagccgtgcgctatgac
cgtacctatttcgataaaattgtagcgtccttgctgcctctgctggaaaaactcaccacc
ggcaagaccgcagagctgctggcaccgaactatatggacatgaatgacccccggccgata
tttgactgggagcaggtcattcgcaagcgcggcattgtttatgtcgggctggatgctttg
tccgacggtgtggtcgcctctgccgtcggcaacagcatgtttgctgacctggtgtcagtg
gccggccatatctataaacacggcatgcatggcgggctacctactcgtgccgacggcagg
ctgccgatcaatctgcactgtgatgagtttaacgagctcatgggcgacgaatttatccct
ctcatcaacaaaggcggtggcgccggcatgcaagtgacggcttacacgcaaaccgagtcg
gacatcgaggcccgcattgggagcacagctaaggcggcccaggtcacgggtaacttcaat
accctgatcatgctgcgggtgcgtgagaatcggaccgcacagttgctgacgacacagctc
ccggaggtcgatgcctacaccaaaactctggtgtcggggcacgccgatacggccgacgtc
gagaaagggcaggacttcacgtccagcactcaggatcgcgttggtacggtgaaaacgccg
ctgctgatgccggcggatgtgatcaacctgccgaaggggcaggcgttcgcgttactggaa
ggcgggcagttgtggaaaattcggatgcccttacccagtggggatggcgatgatgagttg
atgccacctaacctagagaagattgccgaggagatgcagcgcaattaccggaccagtgaa
tcctggtggtcagccagcacggtaatgcctgatgcggtcataaaagggggactgaatgtc
acaagcggtgaataa

DBGET integrated database retrieval system