KEGG   Serratia proteamaculans: Spro_4179Help
Entry
Spro_4179         CDS       T00595                                 

Definition
(GenBank) putative plasmid transfer protein
Organism
spe  Serratia proteamaculans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 T4SS-DNA_transf
Motif
Other DBs
NCBI-ProteinID: ABV43273
UniProt: A8GJI3
Position
complement(4632461..4634575)
Genome map
AA seq 704 aa AA seqDB search
MSNRHVMEALLRPAVELNTAIVAGAAAAICFVAPWSVALAPSVSYVTASGFAVLSAIRAR
QGMQVIRYRRNLRRLPRYVMTSAQIPVSRQRLFLGRGFRWQQKHTQRLMDTRRPEVEKYV
QPPKMYQMARRLELKTEYTLPWLSQLLRTDSLLNPVRPLPPVGGNPAIHGIEPDELDVSM
DLRERVGHSLVLGTTRVGKTRLAELLITQDIRRGDITIVFDPKGDADLLRRVWAEAHRAG
RGDELFIFHLGWPDISARYNAVGRFERVSEVAGRISGQLSGEGNSAAFREFAWRFVNIVA
RALVALGQRPDYTLITRYVNNISELYETYAKKVIETRMPALQQQIDNNLQVLTEEDVPRN
MQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLAPNYMDMNDPRPIFDWEQVIRKRGIVYVGLDALSDGVVASAVGNSMFADLVSV
AGHIYKHGMHGGLPTRADGKLPINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTES
DIEARIGSTAKAAQVTGNFNTLIMLRVRENRTAQLLTTQLPEVDVYTKTLVSGHADTADI
EKGQDFTSSTQDRVGTVKTPLLMPADVINLPKGQAFALLEGGQLWKIRMPLPSGDGDDAL
MPPNLQKIAEEMQRNYRTSESWWSASTVMPDAVIKGGLNVTNGE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcgccacgtgatggaagcattgctgcgtccagcagtcgagttgaatacagcg
attgtggccggtgccgcagccgctatttgttttgttgccccttggtcagtggccttggca
ccgtcggtgagttatgtcactgccagcgggtttgcggtgttatctgctatacgagcccgt
cagggcatgcaggtgatccgctatcgccgtaatctgcgccggctgccgcgctacgtcatg
accagcgcacagatcccggttagccggcagcggttgttcctggggcggggttttcgctgg
cagcaaaagcacacccagcgcctgatggatacccgtcgtccagaggttgagaagtatgtt
cagccgccaaaaatgtatcagatggcgcgtcgcctggagcttaaaaccgaatacaccctg
ccgtggttatcccagttgctgcgcaccgactccctgctgaatccggtcaggccgttgccg
ccggtcggtgggaacccggcgattcatggtattgaacccgatgaactggatgtttcgatg
gatttgcgtgaacgcgtgggccacagtctggtactgggtactacgcgtgttggcaaaacg
cgtctcgccgagttgctgatcacccaggatattcggcgtggtgacatcaccatcgtgttt
gatccgaaaggcgatgcagacctgctgcggcgtgtctgggccgaagcccaccgtgccggc
cgcggggatgagctgttcatctttcatctgggttggccagatatctcggcacgctataac
gccgtcgggcgttttgagcgtgtgtcggaagtggccgggcgtatctccgggcagttgagt
ggggagggcaacagtgcggcattccgcgagtttgcctggcgattcgtcaacatcgtcgcg
cgtgccctggttgcgttggggcagcgcccggactacaccctgatcacccggtatgtgaac
aacatcagtgaactgtatgagacctacgcgaagaaggtgattgaaacgcgtatgccggca
ctgcagcagcaaatcgacaataacctgcaggtgctgacggaagaggatgtgccgcgcaat
atgcagggacaaccgaacgcggtcaaaatatttgcagtcgaaatggccctgagctcggaa
gccggcaagcagctgtatgatcctatcctggatggactgcgctcggccgtgcgctatgac
cgcacctattttgataaaattgtggcgtcactgctgccgttgctggaaaaactcaccacc
ggcaagaccgcagagctgctggcgccgaactacatggacatgaatgacccccggccgata
tttgactgggaacaggtcatccgcaagcgcggtattgtttacgtcgggctggatgcgttg
tcggacggagtggttgcctctgccgtcggcaacagtatgtttgctgacctggtgtctgtg
gccggccatatctataaacacggcatgcatggcgggttgccgacccgcgcagacggcaaa
ctgccgatcaacctgcactgtgacgagttcaatgagttgatgggggacgaatttatccct
ctcatcaacaaaggcggtggcgccggcatgcaggtgacggcttacacgcaaaccgagtcg
gacattgaggcgcgcatcggcagtaccgccaaggcggcccaggtgacgggtaacttcaat
actctgatcatgctgcgcgtgcgagagaaccgaaccgcacagctactgacgacacagctc
ccggaggtcgatgtctacaccaaaaccctggtgtcggggcacgctgatacggccgacatc
gagaaagggcaggacttcacgtccagtactcaggatcgcgtcggtacggtaaaaacgccg
ctgttgatgccggcggatgtgattaatctgccgaaggggcaggcgttcgcgctgctggaa
ggtgggcaattatggaaaatcaggatgcctttaccgagtggcgacggcgatgatgcgttg
atgccacccaacctgcagaagattgccgaggagatgcaacgcaattaccggaccagtgaa
tcctggtggtcagccagcacagtcatgccagatgcggtcataaaaggggggctgaatgtc
acaaacggtgaataa

DBGET integrated database retrieval system