KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_1165
Entry
SPP_1165          CDS       T00874                                 
Name
(GenBank) ftsk/spoiiie family protein
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
SSDB
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_19 AAA_10 AAA_22 ResIII Pox_A32 TrwB_AAD_bind T2SSE Calcyon
Other DBs
NCBI-ProteinID: ACO22165
Position
complement(1084150..1085535)
AA seq 461 aa
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPY
LIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDS
AGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESDLYCELTDKELKD
SYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILT
LIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQM
KNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILA
CQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaaacagcgtggtaaaaggattcgcccatctggtaaagatttagtctttcattttacg
atagcgtcactcctgcctgttttcctgctggttgtcggactgtttcatgtgaagacaatc
cagcagatcaactggcaggattttaacctatcacaagcagataagattgacattccctat
ttaattatcagtttcagtgtcgcaattcttatctgcttgctggtagcgtttgtattcaaa
cgggttcgctatgatacggttaaacaactttaccaccgtcaaaaactggcaaagatgata
cttgaaaacaagtggtatgaatctgaacaggtcaaaacagagggtttctttaaagatagt
gctggtcgtacaaaggaaaagataacctacttccctaaaatgtattatcgacttaaaaat
ggcttgatacagatacgggtggaaatcacgctgggaaaatatcaagaccaactcttacac
ttggaaaagaaattagagagtgacttgtactgtgagctgacggataaagagttaaaggat
tcctatgtggaatatactttgctctatgacaccatagccagtcgtatttctattgatgaa
gtagaagctaaagatggtaaacttcgcttaatgaaaaacgtatggtgggaatatgataag
ctccctcatatgttgattgctggtggtacaggtggcggtaaaacttactttatactgaca
ctgattgaagccttgcttcatacagattcaaaactgtatattcttgacccgaaaaatgct
gaccttgcggacttaggttctgtgatggcaaatgtctactatagaaaagaagacttgctt
tcttgcattgaaacattctatgaagaaatgatgaaacgtagtgaggaaatgaagcagatg
aagaactataagactggcaaaaattatgcttacttaggtctcccggcacacttcttaatc
tttgatgaatacgtcgctttcatggaaatgctgggaacaaaagaaaacaccgcagttatg
aataagctgaaacagattgtcatgttaggtcgtcaagctggcttctttctaatactggct
tgtcaacgtccagacgcaaaatatttaggcgacggaatccgtgatcagtttaatttcaga
gtggctttaggtcgtatgtctgaaatgggctatggcatgatgtttggcagtgacgtacaa
aaggatttcttcttaaagcgaatcaaaggtcgtggctatgttgatgtaggaacaagtgtc
atatcagagttttatactccccttgtaccaaaaggatatgatttcttggaggaaattaaa
aagttatccaacagcagacagtccacgcaggcgacgtgcgaagcggaagtcgcaggtgtg
gactga

DBGET integrated database retrieval system