KEGG   Serratia plymuthica AS9: SerAS9_0283
Entry
SerAS9_0283       CDS       T01503                                 
Name
(GenBank) conjugative coupling factor TraD, SXT/TOL subfamily
Organism
srr  Serratia plymuthica AS9
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 T4SS-DNA_transf
Other DBs
NCBI-ProteinID: AEF43445
Position
332263..334377
AA seq 704 aa
MSNRHVMEALLRPAVELNTAIVAGTAAVICFVAPWSVALAPEVSYVTAGSFAVLSAIRAR
QGMQVIRYRRNLRRLPRYVMTSAQIPVSRQRLFLGRGFRWQQKHIQRLMDTRRPEVEKYV
QPPQLYQMARRLELKTEYTLPWLSQLLRKDSALNPVRPLPPVGGNPAIHGIEPDELDVSM
DLRERVGHSLVLGTTRVGKTRLAELLITQDIRRGDITIVFDPKGDADLLRRVWAEAHRAG
RGDELFIFHLGWPDISARYNAVGRFERVSEVAGRISGQLSGEGNSAAFREFAWRFVNIVA
RALVALGQRPDYTLITRYVNNISELYETYAKKVIETRMPALQQQIDNNLKVLTEEDVPRN
MQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLAPNYMDMNDPRPIFDWEQVIRKQGIVYVGLDALSDGVVASAVGNSMFADLVSV
AGHIYKHGMHGGLPTRADGKLPINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTES
DIEARIGSTAKAAQVTGNFNTLIMLRVRENRTAQLLTTQLPEVDVYTKTLVSGHADTADV
EKGQDFTSSTQDRVGTVKTPLLMPADVINLPKGQAFALLEGGQLWKIRMPLPSGDGDDAL
MPPNLEKIAEEMQRNYRTSESWWSASTVMPDAVIKGGLNVTSGE
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgagtaatcgccacgtgatggaagcgttgctgcgcccggcagtcgaattgaatacagcg
attgtggctggcaccgcagctgtcatttgttttgttgctccctggtcggtagcgctggca
ccagaggtgagctatgtcaccgccggcagctttgcggtgttatctgccatacgagcccgt
cagggcatgcaggtgatccgctatcgccgcaatctgcgccggctgccgcggtatgtcatg
accagtgcccaaatcccggtcagccggcagcggttgttcctggggcggggttttcgctgg
cagcaaaagcacatccagcggctgatggatacccgtcgtccagaggttgagaagtatgtt
cagccgccgcagctgtaccagatggcgcggcgcctggagcttaaaaccgaatacacccta
ccgtggttatcccagttgctgcgcaaagactccgcattgaacccggtcaggccgttgcca
ccggtcggagggaacccggcaattcatggtattgagcccgatgagctggatgtttcgatg
gatttgcgtgaacgcgtgggccacagcctggtactgggtactacccgtgtgggtaaaacg
cgtctagctgagttgctgatcacccaggatattcggcgcggtgacatcaccatcgtgttt
gatccgaaaggcgatgcggacttgctgcggcgtgtctgggctgaagcccaccgtgccggc
cgtggggatgagctgttcatcttccatctgggttggccggatatctcggcacgctataac
gccgtcggtcgctttgaacgggtatcggaagtcgccggccgtatctccgggcagttgagt
ggggagggcaacagtgcggcattccgcgagtttgcctggcgattcgtcaacatcgtcgcg
cgtgccctggtcgcgttggggcagcgaccggactacaccctcatcacccgctatgtgaac
aacatcagcgaactgtatgagacctacgcgaaaaaggtcattgaaacgcgtatgccggca
ctgcagcagcagatagataacaacctgaaagtgctgacggaggaggacgtgccgcgcaac
atgcagggacaaccgaacgcggtcaaaatattcgctgttgaaatggccctgagctcggaa
gctggcaagcagctgtacgaccctatcctggatggcttgcgctcagccgtgcgctatgac
cgtacctatttcgataaaattgtagcgtccttgctgcctctgctggaaaaactcaccacc
ggcaagaccgcagagctgctggcaccgaactatatggacatgaatgacccccggccgata
tttgattgggagcaggtcatccgaaagcagggcattgtctacgtagggctggatgcgctg
tcggacggtgtggtcgcctctgccgtcggtaacagcatgtttgctgatctggtgtcagtg
gctggccatatctataaacacggcatgcatggcgggttgccgacccgtgccgacggcaaa
ctgccgatcaacctgcactgcgatgagtttaacgaactgatgggggacgaatttattcct
ctcatcaacaaaggcggtggcgccggcatgcaggtgacggcttacacgcaaaccgagtcg
gacatcgaggctcgcataggcagtaccgccaaggctgcccaggtgacgggtaactttaat
accctgatcatgctgcgcgtgcgagagaaccggaccgcacagctactgacaacacagctc
ccggaggtcgatgtctacaccaaaaccctggtgtcggggcacgccgatacggccgacgtc
gagaaagggcaggacttcacgtccagcacccaggatcgcgttggtacggtgaaaacgccg
ctgctgatgccggcggatgtgatcaacctgccgaaggggcaggcgttcgcgttgctggaa
ggcgggcagttgtggaaaattcggatgcccttacccagtggggatggcgatgatgcgttg
atgccacctaacctagagaagattgccgaggagatgcagcgcaattaccggaccagtgaa
tcctggtggtcagccagcacggtaatgcctgatgcggtcataaaagggggactgaatgtc
acaagcggtgaataa

DBGET integrated database retrieval system