KEGG   Sulfurisphaera tokodaii: STK_03050
Entry
STK_03050         CDS       T00062                                 
Symbol
orc1-1
Name
(GenBank) Orc1/Cdc6 initiator protein 1
  KO
K10725  archaeal cell division control protein 6
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_03050 (orc1-1)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    STK_03050 (orc1-1)
SSDB
Motif
Pfam: Cdc6_C AAA_22 AAA_16 AAA NB-ARC ATPase_2 TniB DUF815 DEAD Cytidylate_kin ResIII AAA_assoc_2 SLFN-g3_helicase PIF1 NACHT Membrane_bind AAA_7 AAA_lid_10 Bac_DnaA E2F_TDP KAP_NTPase TsaE Torsin Sigma54_activat RuvB_N DAO_C AAA_24 AAA_18 ATP-synt_ab HTH_54 APG12 AAA_14 RNA_helicase DUF468
Other DBs
NCBI-ProteinID: BAB65275
UniProt: Q975X3
Position
complement(322243..323439)
AA seq 398 aa
MSKIIDEILSSLSRSRIFRNRELLLPDYVPEELPHREEQIKRLVEILSPLMRGEKPNNIF
IYGLTGTGKTAVTKFVVKKLHEKISNSFIYVYINTRQTDTPYRILADLLENLGSKVPFTG
ISTAELYRRFIKKVLELKPILVIVLDEIDALVKKHGDDILYRLTRANYEMGKSKVSIIGI
TNDIKFVEFLDPRVKSSLSEEEIVFPPYNAEELEDILKRRATLAFYDSVVSDDVIKLCAA
IAARDHGDARRALDLLRVAGEVAERDGAEKLTIEHVNKARVEIERDRVYEVVSTLPFHSK
LVLLAIVIGVNEKRRTLTTGEVYDVYTKLAKKIGVESVTQRRVSDIINELDMLGIITARV
VNRGRYGKTKEVNLAVNEETVIKAISEKDSKIASLWDR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgagtaagattattgatgagatattatcatccttaagtcgttctagaatctttagaaac
agagagttattattaccagattatgttccagaagagttacctcatagagaagagcaaatt
aaaagattagttgaaatactttctccattaatgcgaggagaaaaaccaaataatattttc
atctatggtttaacgggaactggaaaaactgctgtaacaaaatttgtggtcaagaagctt
catgagaaaatatccaattcttttatttatgtatatattaatactaggcaaacagatacc
ccatacagaattttggctgatcttcttgaaaatttaggttcaaaggtcccttttacagga
atttctactgcagaattatataggcgatttatcaaaaaagtattagaattaaagccaatt
ttagttatagttttagatgagatagatgccttagtcaaaaagcatggtgatgatatttta
tatagattaactagggctaattacgaaatgggtaaaagtaaggtatctataataggtata
actaatgatattaaatttgttgagtttcttgatcctagggttaaaagtagtttaagtgaa
gaggaaatagtatttcctccctataatgctgaagaattagaggacattctaaaaaggagg
gctactttagcattttatgattccgtcgtttctgatgatgtaattaaattatgtgctgct
attgctgcaagagatcatggagatgcaagaagggctttagatcttttaagagttgcgggt
gaagtagcagagagagatggtgccgaaaaattaactatagagcatgtaaacaaagctagg
gttgaaatagaaagagatagagtatatgaggttgtttcaactctcccttttcattctaag
ttagttcttttagctattgtgatcggtgttaatgaaaaaaggagaacccttactactgga
gaagtttatgacgtatacactaagttagctaagaagattggtgttgaaagtgttactcaa
aggcgagttagtgatattattaatgaattagatatgttaggaattattactgcaagggtt
gtgaatagagggagatatgggaaaactaaggaagtcaacctagcagttaatgaggaaaca
gttattaaggcaatttctgaaaaagatagtaaaattgctagtctctgggatagatga

DBGET integrated database retrieval system