KEGG   Sulfurisphaera tokodaii: STK_03130
Entry
STK_03130         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Phage_integrase Phage_integr_3 HTH_7 HTH_31 DUF445 HTH_3 HTH_29 HTH_23 HTH_28
Other DBs
NCBI-ProteinID: BAB65286
UniProt: Q975W2
Position
328662..329960
AA seq 432 aa
MVSFDISKLNYDQRLRVLKKAVEKHGKAYIARVCNVNLATIYRYLNGQISTIPDEVIEKA
LQTLTVEEISDAIYGLRTVEVDPTTALSVVVKAMKDEGFRNFFLSLLYKYLGDYLKQTSQ
SYIVTEEDVELFEKIVRETRTKKTADDIIRYLTRALAELNNELTPDRLKEYIFELTEENR
GRARHTAKALKLFIKEVVKTRDSHLARELYDSFKIPKAKTNYKPVSLSLDTLKQIFNNIE
DLGAKAFFLILTETGLRVGEVLNLRVDQIDLEHRVIRIMKESETKRAYISFLHEGTAKWL
KEVYLPYREDFVKRYELNVRKLAEANPDQNIDIEAWKTKLFPFREDMLRAEIKIAMRKVG
KEFRLYDLRSFFASYMIKQGVSPMIVNLLQGRAPPQQFQILQNHYLAISDIELQQYYDKY
APRLLETVPTYS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggtcagtttcgatatttcaaagttaaactatgatcaaagactccgcgtgcttaagaag
gcagtagaaaagcatggtaaggcatatattgcgagagtatgcaatgttaacttagctact
atttatcgttatttaaatggtcagatttcaacaataccagatgaggtaattgagaaggca
cttcaaacattaacagttgaagagattagtgatgcgatctatggtctaaggactgtagaa
gttgatccaacgactgctttaagtgtagtagttaaggcaatgaaggatgagggttttcga
aacttcttcctatccttactttataaatacttaggagattatttaaagcaaacatctcag
tcctatatcgttacagaagaagatgttgaactgtttgagaagattgttagagagaccaga
actaagaagacagcagatgatataatcaggtatttaacacgtgctttagcagaattaaat
aatgaactgacccctgataggttaaaggagtatatatttgaattaacggaagaaaatagg
ggtagagctagacacactgcaaaagcattaaaactcttcattaaagaagtagtaaagaca
agggatagccacttagcacgagagttatatgattcatttaaaatacctaaagctaagact
aattataagcccgtcagcctgagcttagatacattaaaacaaatatttaacaatatagag
gatttgggtgctaaagcattcttcttgattttgactgaaactgggctgagagtaggcgaa
gtattaaacttaagagtagaccaaattgacttagagcacagagttattaggattatgaag
gagagtgagactaaaagagcttacatatcatttcttcatgagggtactgctaaatggtta
aaagaagtttatttaccttaccgcgaagatttcgttaaacgttatgagctcaacgtcaga
aaattagccgaggctaaccctgaccaaaatatagatattgaggcgtggaagacaaaacta
ttcccattcagagaggatatgcttagagctgagattaaaattgcaatgaggaaagtgggc
aaagagttcaggctttatgatttaagatcattcttcgcatcttacatgattaaacaaggt
gtttccccaatgatagtgaatttattgcagggtagagcaccaccacagcaatttcagata
ctacaaaaccattatttagcaatctcagatattgaactacagcagtactatgataaatat
gctccacgcctcttagagactgttccaacatattcttag

DBGET integrated database retrieval system