KEGG   Sulfurisphaera tokodaii: STK_04750
Entry
STK_04750         CDS       T00062                                 
Symbol
rfcS
Name
(GenBank) replication factor C small subunit
  KO
K04801  replication factor C small subunit
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STK_04750 (rfcS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_04750 (rfcS)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     STK_04750 (rfcS)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 RuvB_N AAA_22 DNA_pol3_delta Rad17 AAA_3 AAA_14 AAA_18 nSTAND3 AAA_assoc_2 AAA_24 AAA_16 AAA_11 ResIII ATPase_2 SLFN-g3_helicase Mg_chelatase AAA_7 AAA_5 TIP49 AAA_2 AAA_30 AAA_19 DUF815 IstB_IS21 T2SSE AAA_28 KTI12 AAA_25 FtsK_SpoIIIE bpMoxR NTPase_1 RNA_helicase DUF4011 Viral_helicase1
Other DBs
NCBI-ProteinID: BAK54297
UniProt: Q975D3
Position
complement(476298..477281)
AA seq 327 aa
MSLEEEILWAEKYRPRSLDDIVNQKDIVERLKRFVKDKNMPHLLFSGPPGTGKTTAALAL
VHDLYGDNYRQYFLELNASDERGIDVIRNKVKEFARTVAGGNVPFKVVLLDEADNMTADA
QQALRRTMELYTETTRFILACNYLSKIIEPIQSRTALFRFYPLKKEDVVARLAYIAKNEK
VEYDQKALETIYDITQGDMRKAINILQASSVYGKVTVEAVYKVLGLAQPKEIREMIMLAL
QGNFLKAREKLRELLVNYGLSGEDIIKQIHREVTGNEINIPDDLKVLLVDYIGEVEYRIM
EGADDEIQLNALLAKLAVYGEKYLKGK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtcacttgaggaggaaattctttgggctgaaaaatatagacctagaagccttgatgac
atagttaatcaaaaagatattgtagagagattaaaaagattcgtaaaagataagaatatg
ccccatttacttttctctggtcctcccggtacagggaaaactacagccgccttagcctta
gttcatgatttatacggtgacaattataggcaatattttcttgaacttaatgctagtgat
gaaagaggtatagatgttataaggaataaagttaaggaatttgctagaacagtagctggg
ggaaacgtaccatttaaggtggtgttacttgatgaagcagataatatgactgctgatgct
caacaagctttaagaagaaccatggaattatatacagaaacaacccgtttcattttagct
tgtaattatcttagtaaaataattgaacctatacaatcaagaactgcactttttaggttt
tatccgttaaagaaagaagatgtagtggctagacttgcatatatagctaaaaacgagaaa
gtagagtatgatcagaaggcccttgaaacaatttatgatataactcaaggagacatgaga
aaagcgataaatatacttcaagcttcatcagtatatggtaaagtaactgtagaagctgta
tacaaagttcttggacttgcacagccaaaagaaataagagaaatgattatgttggcacta
caaggaaatttccttaaggcgagagagaagttaagagagttattagtaaattatggattg
tcaggtgaagatattataaaacaaatacatagagaagttacaggtaacgaaataaatatt
ccagatgatttaaaagtattactagtagattatattggtgaggtagaatatagaataatg
gaaggggcagacgacgagatccaactaaatgctcttctagctaaactggccgtttacgga
gaaaagtacttaaaagggaagtaa

DBGET integrated database retrieval system