KEGG   Sulfurisphaera tokodaii: STK_04800
Entry
STK_04800         CDS       T00062                                 
Name
(GenBank) acrylyl-CoA reductase
  KO
K15020  acryloyl-coenzyme A reductase [EC:1.3.1.84]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_04800
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.84  acrylyl-CoA reductase (NADPH)
     STK_04800
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C LDcluster4 adh_short Epimerase DacZ_T ELFV_dehydrog PTS_IIB CMAS Eno-Rase_NADH_b SIS_2
Other DBs
NCBI-ProteinID: BAB65473
UniProt: Q975C8
Position
480166..481170
AA seq 334 aa
MKAIVVPGPKQGYKLEEVPDPKPGKDEVIIRVDRAALCYRDLLQLQGYYPRMKYPVILGH
EVVGTIEEVGENIKGFEVGDKVISLLYAPDGTCEYCQIGEEAYCHHRLGYSEELDGFFAE
KAKIKVTSLVKVPKGTPDEGAVLVPCVTGMIYRGIRRAGGIRKGELVLVTGASGGVGIHA
IQVAKALGAKVIGVTTSEEKAKIIKQYADYVIVGTKFSEEAKKIGDVTLVIDTVGTPTFD
ESLKSLWMGGRIVQIGNVDPSQIYNLRLGYIILKDLKIVGHASATKKDAEDTLKLTQEGK
IKPVIAGTVSLENIDEGYKMIKDKNKVGKVLVKP
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaaagcaattgtagttccaggacctaagcaagggtataaacttgaagaggtacctgat
cctaagccgggaaaagatgaagtaataattagggtagatagagctgctctttgttataga
gatttgcttcaactacaaggatattatccaagaatgaaatacccagttatactagggcat
gaagttgtaggaaccatagaagaagtcggagaaaatataaagggatttgaagtaggtgat
aaagtaatttctttattatatgcaccagatggtacatgcgaatattgccaaataggtgag
gaagcatattgtcatcataggttaggctactcagaagagctagacggattttttgcagag
aaagctaaaattaaagtaactagcttagtaaaggttccaaaaggtaccccagatgaggga
gcagtacttgtaccttgtgtaaccggaatgatatatagaggtattagaagggctggtggt
atacgtaaaggggagctagtgttagttactggtgccagtggtggagtaggaatacatgca
attcaagttgctaaggccttaggtgctaaagttataggggtaacaacatcagaagaaaaa
gcaaagataattaagcagtatgcggattatgtcatcgttggtacaaagttttctgaagaa
gcaaagaagataggtgatgttactttagttattgatactgtgggtactcctactttcgat
gaaagcttaaagtcattgtggatgggcggaaggattgttcaaatagggaatgtcgaccct
tctcaaatctataatttaagattgggctacataatattaaaagatttaaagatagttggt
catgcctcagctaccaaaaaagatgctgaagatacactaaaattaacacaagagggaaaa
attaaaccagttattgcaggaacagtcagtcttgaaaatattgatgaaggttataaaatg
ataaaggataagaataaagtaggcaaagtcttagtaaaaccataa

DBGET integrated database retrieval system