KEGG   Sulfurisphaera tokodaii: STK_05480
Entry
STK_05480         CDS       T00062                                 
Name
(GenBank) ATPase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_14 AAA_16 Vps4_C AAA_5 AAA_22 AAA_2 RuvB_N AAA_18 AAA_17 nSTAND3 RNA_helicase AAA_33 AAA_28 TIP49 Rad17 NACHT AAA_25 DUF815 ATPase_2 TsaE Mg_chelatase IstB_IS21 AAA_24 AAA_7 bpMoxR TniB MCM AAA_3 ABC_tran Parvo_NS1 Viral_helicase1 Zeta_toxin Bac_DnaA Glutaredoxin AFG1_ATPase AAA_6 Adeno_IVa2
Other DBs
NCBI-ProteinID: BAB65545
UniProt: Q974W2
Position
complement(541137..542954)
AA seq 605 aa
MGVTQFIPLIEVLGAVGITIVLLVLLFRKQTQKFILSDKALQIQQKSQKKKEEVKEKITW
DMIGGYDDVKKEIKEYIEIPLKYKEIAKKYGLRPPKGILLFGPPGCGKSLMMRALANEAK
INFIYVNVSDIMSKWYGESEARLRELFANARKNAPCILFFDEIDTIGVKRESHTGDSVTP
RLLSLMLSEIDGLQSEDGVIIVGSTNVPHLLDKALLRAGRFDKLIYIGVPDKKSRKEIFL
IHCKNMPLGEDVDFDKLAEMTERFTGADIANVCQEVARMAAVEALEKGVERKITLQDFIN
VIKRYKPSVTLQMLDEYEKFRLDYERKFRGPELPESEDAEKITLNDIGGYEEIKKELYDL
LEMQFKYYNLMEQMKIPSIRGILLYGPPGVGKTMMAKALARTLGVRLIMLSGAEILYKGY
EGAVSAVKEVFNRARENKPSILLLDELDAIAPKRENQKSEASKIVNQLLTEMDGIRSLKE
VVVIGTTNRLEDIDPALKRPGRFDRIIYMPLPNKDERKDIFEKYLGKDICEQVNCDKLAD
ITEGYSGADIAAVTREAKLKVLKEIIRGNKERKLTYEDLLEAIAKVKPSVKKEQLNSTSS
DLKKE
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgggagttactcaatttattccattaatagaggttcttggtgctgttggaattacaata
gtccttctggttctcctattcagaaagcagactcaaaagttcatattatcagacaaagct
ctacaaatacaacaaaagtctcagaaaaagaaagaagaagttaaagaaaaaattacatgg
gatatgatcggtggatatgatgatgtaaaaaaagaaattaaagaatatatagagattcca
ctgaagtataaggaaatagctaaaaaatatggattgagacctccgaaagggattttacta
tttggtccacctggttgtggtaagagcttaatgatgagagcactagcaaatgaggcaaaa
attaactttatttatgttaatgtaagcgatatcatgagcaaatggtacggcgaaagtgaa
gctagacttagagaattgtttgcaaatgctaggaaaaacgcaccatgcatattatttttt
gacgaaatagatactataggagttaaaagagaaagtcatactggagattctgtcacgcct
agattactttctctgatgctgtcagagatagatggattacaaagcgaagatggggttatt
attgttggttctactaacgttccacatcttttagataaagcactcttaagggcaggtaga
tttgataaactaatttatattggtgtgcctgataaaaaatctagaaaagagatatttctt
attcattgtaagaatatgcctttaggtgaagatgttgactttgataaattagccgaaatg
acagaaagattcaccggagccgatatagcaaatgtatgccaagaagttgctagaatggct
gctgtagaggcattagaaaagggagtagaaagaaaaataacactacaagatttcataaac
gtaattaagagatataaaccaagtgtaactctacaaatgcttgatgaatatgagaagttt
aggttagattatgagagaaagttcagaggacccgagttaccagaatcagaggatgctgaa
aaaataactttaaatgatataggaggatatgaagagataaagaaagaattatatgattta
ctagaaatgcaattcaagtactataatttaatggaacaaatgaagattccatcaattaga
ggaattttactttacggacctccaggtgtaggtaaaacaatgatggctaaagcactagca
agaactttaggtgttagattaattatgctaagtggagcagaaattctttataagggatat
gagggtgctgtttcagcagttaaagaagtatttaacagagctagagagaataagccttcc
atcttactattagatgagcttgacgctattgctcctaaacgtgaaaaccaaaagtcagag
gcttcaaaaatagttaaccaacttctaactgaaatggacggaattagaagtttgaaggaa
gtagtggttataggaactacaaatagattagaagatatcgatccagcattaaaaagacca
ggcagatttgatagaataatttatatgccattacctaataaagatgaaagaaaagatata
tttgaaaagtacttaggtaaagatatatgtgaacaagtgaattgcgataaattggctgac
attactgagggttacagcggagctgatatagctgctgtaacaagagaagcaaaactgaaa
gtcttaaaggaaataataaggggaaacaaagaaagaaaattgacttatgaagacttatta
gaagctattgcaaaagttaagccttctgtaaagaaagagcaattaaattcaacaagttct
gatctgaagaaagaataa

DBGET integrated database retrieval system