KEGG   Sulfurisphaera tokodaii: STK_10920
Entry
STK_10920         CDS       T00062                                 
Name
(GenBank) transposase
  KO
K07450  putative resolvase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_10920
SSDB
Motif
Pfam: Resolvase HTH_17 MerR YfeC-like Rv2175c_wHTH cwf21 TFIID_20kDa HTH_23 Phage_AlpA HTH_3 HTH_29 CLP1_P
Other DBs
NCBI-ProteinID: BAB66124
UniProt: Q972P0
Position
complement(1074247..1074864)
AA seq 205 aa
MERYLTPSEVAEIFGMSRSGVIKWIREGKIKAIEINGRWRIPYSEVERLLSGGGRLKQVA
IYARVSSNTQKDDLERQINALREWVKKNYGNVSVIEIKDVGSGLKEDRRGLKKLIELSRR
RQIDVVVVAYKDRLTRFGFDYLVELFKAYGVGVVVAFQEEPKDYMQELVEDFVEIVRSFA
SRIYGHRSHKYEKVIKCVEDAEKDG
NT seq 618 nt   +upstreamnt  +downstreamnt
gtggagagatacctaactccaagtgaggttgccgaaatattcgggatgagtaggagtggg
gtgataaagtggatcagggaggggaagataaaagctattgaaattaacggtaggtggagg
atcccttacagcgaagtagagaggttgttgagcggtggcggtaggctcaaacaggtcgca
atttacgctagggtctcatcaaacactcaaaaggacgacttggagaggcaaataaacgcg
ttgagggaatgggttaagaagaattacggcaatgtgagcgttattgagatcaaggacgta
gggtctgggctgaaggaggacagaagggggttaaagaagctgattgagttgtctaggagg
aggcagatagatgttgtagtagtagcttacaaggacaggctcacacgcttcggcttcgac
tacctcgttgagctgttcaaggcttacggggttggcgtagtcgtggcttttcaagaggaa
ccaaaggactacatgcaagagttagtggaggacttcgttgagattgtcaggtccttcgct
tctaggatctatggacatagatcccataaatacgagaaggtgatcaagtgtgttgaagac
gctgagaaggacggttag

DBGET integrated database retrieval system