KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4270
Entry
t4270             CDS       T00121                                 
Name
(GenBank) hypothetical protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG ResIII HerA_C AAA_22 AAA_29 AAA_7 FtsK_SpoIIIE T2SSE DUF87 ATPase_2
Other DBs
NCBI-ProteinID: AAO71728
UniProt: Q8Z1J2
Position
4434988..4437411
AA seq 807 aa
MNRLASYIKPHAQRTAFTKAWLAETEQHLRNITRPEGLFTDSLVTGVPWRGQNRSVRMVV
YRYLPANYKDDSPVAALNQVCERLTSALSAAGVLSVRQNGEQIHRWLLRHFNPEPDWIDK
DTLYREARYYDDAPDSLPLGNDFTETLWFNPPRSDTRNGVWWFDNVAHRAVPVETLRRPP
GPGHLTGEVKRGDNINTLMDLLPEGTMVSLTIVAQAQDTLEAGFDTLGKNAIGQNTESRR
TRSDVEQVKSLLGMRHKLYRASITFLMRAPDVSELNKKIQQLTATLLTAGLQPTKPEYEV
APLNDYLRALPMCFNPQLDKKNWYTRLTWVQHLAGLLPVTGRSQGTGHPGFSFFNRGGEL
LSFDPLNSLDRTQNAHLLLFGPTGAGKSATLCSALSQLMAVHRPRLFIAEAGNSFGLLAE
YFRGLGLSVNVLSIKPGCGISLPMFADAHSLMRVDPKKNVVSEEALPELEPANTDSAEDE
SEERDILGEMEIAARMMITGGEKREEERLTRADRGLIREAIMMAAEKTYQDGHQMLAEDL
QAALWNISRDNSIGANGEPMRNQSRRDRAAEMAEAMAMFTQGFEGELFNRPGTPWPEADV
TLIDLGHLAREGYGAQMALAMVSLINTINNIAERDQGTARDIVAVFDEAHISTTNPLLSP
YMTKVVKMWRKLGAWLWLATQNLEDFPDIAQKMLNMAEWWLCLVMPPDEVEQIARFKTLS
EEQKVILRSASKLKNCYTEGVVLSKQVEALFRVVPPSLYLALGMTEKEEKAERQRLMREY
QCSELEAAIRVARRLDEARGFCPQKAA
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgaatcggttagccagttacatcaaaccgcatgctcagaggacggcatttacgaaggcc
tggctggctgaaacagaacagcatctgcgaaatatcacccggccggaaggtttgttcact
gattcacttgtcaccggggttccctggcggggacaaaatcgttccgtcaggatggtggta
tatcgatacctgccagcgaattacaaagatgattcgccggttgccgctctcaaccaggtt
tgtgagcgcctgacttcagccttatctgcagccggcgttctgagtgtccgacagaatggc
gagcagatacatcgatggttgttacgtcacttcaatcctgagcccgactggatagacaaa
gatacgctttaccgggaggctcgttattatgatgatgcacctgattcattgcctcttggc
aatgatttcactgagacgttgtggtttaaccctccacgttctgatacccgaaatggtgtg
tggtggtttgataatgtggcgcatcgtgccgttcctgttgaaacattacgtcgccctccg
ggacccggtcatctgacgggggaggttaagcgtggcgacaatattaatactctgatggat
ttattgcctgagggcacaatggtatcgctcactattgtggcgcaggctcaggacacgctg
gaagccgggtttgacacgctgggtaaaaatgcaatagggcagaacacggaatccaggcgg
acccgtagtgatgtggagcaggtgaagagtttgctgggcatgcgtcacaaactttatcgt
gcatcgataacttttttgatgcgtgcacctgatgtcagtgagctgaataaaaaaatacag
caacttaccgctacattgctgactgcggggctccagcccacgaaacctgaatacgaagtg
gcgcccctgaatgactatttgcgagcgcttcctatgtgttttaacccgcaactggataaa
aaaaactggtatacccgcctgacctgggttcagcatctggctggattgcttcccgtgacc
ggtcgcagccagggaaccggacaccccgggtttagtttttttaaccgtggcggagaactg
ttgtcttttgatcccttaaatagtctggacagaacgcagaatgctcacctgttgcttttt
ggtccgaccggggcgggtaaatcagccaccttatgtagtgcgttatcacagttaatggcc
gttcatcgtccacgcctctttattgccgaagccggcaacagttttggtttgctggcggag
tatttccgggggctgggactgagcgtaaatgtactgagtatcaaacctggctgcggtatt
tctttaccgatgtttgctgatgctcattccttaatgcgagtagatccaaagaaaaacgtg
gtttctgaggaagctctacctgagctggagccagccaataccgacagcgcagaagatgaa
agtgaagagcgtgacattcttggcgaaatggaaattgcagcccggatgatgatcaccggt
ggcgagaagcgggaggaggaacgtcttacccgggctgaccgcggtcttattcgtgaagct
atcatgatggcggcggagaaaacatatcaggacggacatcagatgctggctgaggattta
caggctgccctgtggaatatctcacgtgataattccattggtgcaaatggcgagcctatg
cggaatcagtcccgtcgcgatcgtgctgctgagatggcagaagccatggccatgttcact
cagggatttgagggagagttattcaaccgtccgggaacaccatggccagaggctgatgtc
acactgatcgatttaggtcatctggcacgtgaaggctatggtgcacaaatggcgctggcg
atggtctctttaattaacacgattaacaatatcgccgaacgtgaccagggaacagcccgg
gatattgtggccgtatttgatgaagcccatatttccacgacgaatcctttgttgtcgccc
tatatgaccaaggttgtgaaaatgtggcgaaaactgggggcatggctgtggctggcgaca
cagaacctcgaggattttcctgatattgcgcagaaaatgctgaacatggctgaatggtgg
ttgtgcctggttatgcctcccgatgaggtggagcagattgcccgtttcaaaaccctcagc
gaggagcaaaaagttattttgcgatcagccagtaagctcaaaaactgttataccgagggc
gtcgttttatcaaagcaggttgaggcactgttccgggttgtgcctcccagtctgtatctc
gccctggggatgactgaaaaagaggaaaaagcggaacgtcagcggctgatgcgagagtat
cagtgcagtgagcttgaggcagcgatccgggtggcccgcaggctggatgaggcacggggt
ttttgtccacaaaaagcggcctga

DBGET integrated database retrieval system