KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4562
Entry
STY4562           CDS       T00064                                 
Name
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87
Other DBs
NCBI-GeneID: 1250767
NCBI-ProteinID: NP_458648
UniProt: A0A716XU76 Q8Z1K2
Position
4442121..4444211
AA seq 696 aa
MSNRYVMEALLRPAVELYSAAAGGAATFVLVVAPWSMALAPQVSYVTAAGFAIFTTIRTR
QGLRILRYRRNIRRLPRYQMSSESIPVSRHFLFLGKGFMWEQKHTQRLLETKRPEVAPFL
KPSVFYSLARQFERRYEYTFPGLCSLTRRDSFFNPVRPLPPVGGNSAIHGVEMEEDNVLM
SLTERVGHLLVLGTTRVGKTRLAELLITQDIRRGNVTIVFDPKGDADLLKRMWAETRRAG
RSDEFYIFHLGWPDISARYNAVGRFGRVSEVASRVAGQLGGEGNNAAFKEFAWRFVNIIA
RALVVLGLRPDYSLILRYVTNIAELYETYAEKLLTQQAPELWLMVQNQMGILTEDDLPRT
MQGQVNAIRVMAIEVALSSEQGKKIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAALLSPDYSDMNDPRPLIDWQEIIRKGGVVYVGLDALSDSEVASAVGNSMFADLVST
AGYIYKFGLSDDMPEGSSQRLPISLHCDEFNELMGEEFIPMINKGGGAGIEVTAYTQTWS
DIEAKIGNAAKAAQVTGNFNNMIMLRVREKTTAELLTTQLPEVEIYTKTLVSGVTDISNP
DQGSDFTSNVQDRVSSTRVPLLSPAEVMNLPKGQAFALLEGGRLWKIRMPLPASVDDEMM
PVNLQSIVTTMRKHYRTGDTWWSGSVLPGDNLVDAL
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgagtaaccgttatgtcatggaggcgttattgaggccagcagtagaactctattcagct
gcggctggcggggctgccacttttgttctggttgtcgcaccatggtcgatggcgttagca
ccacaggtcagttatgtgactgcagccggttttgccattttcacaacaatcagaactcgt
cagggtttgcgcatcttgcgctatcgacgcaatatccgtcggttaccccggtatcagatg
tccagtgaatccataccggtaagccgacattttttgtttctggggaaaggctttatgtgg
gagcaaaagcatacccaacgtttgcttgagacgaaacggccggaagttgctccctttctg
aaaccgtcagttttttactccctggctcgtcagtttgaacgacggtatgagtatacattc
cctgggttatgtagcctgacaagacgagattcattttttaatccggtacgcccattaccc
cctgttggtggtaattcggcgatacatggtgtcgagatggaggaagataatgttttgatg
agtcttaccgagcgcgttggacatcttcttgtattaggaacgacacgagttggtaagacc
cgtctggcagaactgttaattacgcaggatattcgcagaggaaatgtcactatcgttttt
gaccccaaaggtgatgctgatctgttgaaacgaatgtgggctgagacgaggcgagctggg
cgtagcgacgagttttatatctttcatcttggctggccagatatcagtgcccgttataat
gcagtcggccgttttggacgcgtatctgaagtggcctcacgtgttgccgggcagcttggg
ggagaaggaaataacgctgcgtttaaagagtttgcatggcgctttgtcaatatcatcgct
cgtgctcttgtcgttcttggtttgcgacctgattattcgcttatcctccggtacgtaaca
aatattgcagagctttatgagacctatgccgagaagttactgactcaacaggctccggag
ttgtggctgatggttcaaaaccagatggggatcctgactgaggatgatttaccacgtacg
atgcagggacaggttaatgctattcgggttatggccattgaagtggcattatccagtgag
cagggcaaaaaaatatacgatcccgtactggatgggttgcgtagcgctgtacgttatgat
cgaacatatttcgataaaatagtcgcttcattgttacctcttctggaaaaactgaccaca
ggcaaaactgcggcactattatctcctgactacagtgatatgaatgatccgcgcccatta
atagactggcaggaaattatacggaaaggcggtgttgtttacgtcggtcttgatgctctt
tcagattctgaagttgcttctgcggtaggtaacagtatgtttgccgatctggtttcaaca
gctggatatatttataagttcggactgtctgatgatatgcccgaagggagtagccagcgg
ttacccatcagtcttcactgtgatgaattcaatgagttaatgggagaagaattcattccg
atgataaataaaggcggtggggcaggtattgaagttacagcctatacccagacctggtca
gatattgaggccaaaattggtaatgcagctaaagctgcccaggtcacaggcaatttcaat
aatatgattatgcttcgtgtgagagagaaaacgacagctgagttgctgacaacgcaatta
cctgaagttgaaatttatacaaaaacactggtttccggtgtgacagatatatccaatccg
gatcaggggagtgatttcacatccaacgttcaggacagagtaagcagtacacgtgttcct
cttttatctcctgcagaagtaatgaatttacctaaagggcaggcttttgcactgctggaa
ggagggcgattatggaagattcgtatgccgctgccggcatccgttgatgatgaaatgatg
ccggtaaacctgcagagtattgtcactacaatgcgtaaacactaccgaacgggagacacc
tggtggtcagggagtgtgctccccggagataatctggtggatgcgctatga

DBGET integrated database retrieval system