KEGG   Synechocystis sp. PCC 6803: sll1143
Entry
sll1143           CDS       T00004                                 

Gene name
uvrD
Definition
(GenBank) DNA helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03420  Nucleotide excision repair
syn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    sll1143 (uvrD)
   03430 Mismatch repair
    sll1143 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:syn03400]
    sll1143 (uvrD)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     sll1143 (uvrD)
DNA repair and recombination proteins [BR:syn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     sll1143 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     sll1143 (uvrD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 DEAD ResIII Helicase_RecD
Other DBs
NCBI-ProteinID: BAA17505
CyanoBase: sll1143
CYORF: sll1143
UniProt: P73465
Position
complement(1022278..1024659)
AA seq 793 aa
MPMTVVPDYLAHLNPSQRRAVEHFCGPLLVVAGAGSGKTRALTYRIAHLIRQHRINPENI
LAVTFTNKAAKEMKERLEKIFAQAWAQQEFSQRWELLGKYEQKQLLSRVYKTVTKPLWIG
TFHSLCSRILRYDIDKYQDSSGRRWTKQFSIFDESDVQSLFKTIVTKDMDLDEKQFNPKS
IRYQVSNAKNLGQSPETYLRENPSYKGRVIAEVYQAYQNQLAANNALDFDDLILIPTRLF
QQNESVLGYWHRKFNHILVDEYQDTNRIQYDLIRLLSTNGEERQSEWDWRGRSTFVVGDA
DQSIYSFRMADFTILLNFQEDFGDRLLDGETTTMVKLEENYRSRENILQAANHLIEHNSQ
RIDKILKATRSGGDDIILYQADDERDESRFVINKILSLRKNNPELNFGDFAILYRTNAQS
RAFEEQLLNNNIRYNIVGGFRFYDRQEIKDAIAYLRVLVNPADTVSLLRIINTPRRGIGK
STIEGFVNASKELDIPLWEIITDETSVNTLAGRSGKKTLQFARMLQEIQSQIGELSASEA
LSLVLEKSNYVDDLKQKGTEEADNRLANLGELDNAVRQFEAESEDPSLVDFLASASLTSD
LDDLEESGDEVSLMTLHSAKGLEFPVVFLVGLEQGTCPHARSLNDPLDLEEERRLCYVGI
TRAQENLFLTHARMRYIWGSLETKIPSQFLQELPPDLLADGSTGRRTGRNAPAADPKGPS
IAQKQARKKTGSQSTQPAKDLIWNVGDRVMHNNFGEGTVTHILGKGHKANLAIKFPGIGV
KIIDPSFAPLRRL
NT seq 2382 nt   +upstreamnt  +downstreamnt
gtgcccatgactgttgtccccgactaccttgcccacctcaatccttcccaacggcgggcg
gtggagcatttttgtggccctcttttggtggtggccggggccggctcagggaaaactagg
gcactaacctaccgcattgcccatctaattcgtcagcatcgcatcaatccggaaaatatc
ctggcggtaacctttaccaataaagccgccaaggaaatgaaggaacgtttggaaaagatt
tttgcccaagcctgggcccaacaggaatttagccaacggtgggaattgttggggaaatat
gaacaaaaacagttgctttccagggtgtacaaaacagttacgaaacccctctggattggc
actttccacagtctatgttctcgtattctccgctacgacattgataaatatcaggacagc
agtggccgccgttggacaaaacagttttccatttttgatgaaagtgacgtgcaaagtttg
tttaagaccattgtcactaaggatatggatttggacgaaaaacagttcaatcctaagagt
attcgctaccaggtcagtaatgccaaaaacctcgggcaatcaccggagacctatctaagg
gaaaatcccagttataaaggtagggtcattgcggaagtttaccaagcttaccaaaatcaa
ttggccgctaataacgctctagattttgatgatttaattctcatccctacccgtttattt
caacaaaatgaatcagttttaggctactggcaccgaaaatttaaccatattttggtggat
gaataccaagacactaatcgcatccaatatgatttaattcgtctgctgagcaccaatggg
gaagaacggcagtcggagtgggattggcgggggcgttccacttttgtggtgggggatgca
gaccaatctatttacagtttccgcatggcagactttaccatcctgctcaatttccaagag
gattttggcgatcgcctgttggatggggaaacgaccaccatggtcaaactagaggaaaat
taccgttctcgggaaaatatcctccaagcggctaaccatttaattgaacataatagccaa
cggattgacaagatcctcaaggctacccggagtggcggagatgatattatcctttaccag
gcggatgatgaaagggatgagtcccgttttgtgattaataaaattctgagcttaaggaaa
aataacccagaattaaattttggtgattttgctattttatatcgcaccaatgcccaatcc
cgggcctttgaagaacagctattaaataataatattcgctacaatattgtcggtggtttt
cgcttctacgatcgccaggaaattaaagatgccattgcctatctccgggtgttagttaat
ccggcggatacggtcagcttgttgcgtatcatcaatactccccggcggggcatcggtaaa
tccaccattgaaggttttgttaatgcctctaaggaattggacattcccctgtgggaaatt
attaccgacgaaacttcggtgaatactctggccgggcgatcaggtaaaaaaaccctgcaa
tttgcccgcatgctccaggaaatccaaagccaaattggtgagctttctgcgtcggaagcc
ctcagcttagtgttggaaaaatccaattatgtggacgacttaaagcaaaaaggcaccgaa
gaagcggataatcgcctggccaacctgggggaattggacaatgcagtgcgacagtttgaa
gcagaaagtgaagaccctagcctagtggattttttggcttcagcatccctcacttccgac
cttgatgacctggaggaatccggagacgaagtgtccctcatgactctccactctgctaag
ggcctggaatttccagtggtcttcttagtggggttggagcagggcacttgcccccacgcc
cgcagtttaaatgatcctttggatctagaagaggaacgccgtttatgttacgtgggcatt
accagagcccaggaaaatctctttttgacccatgctcgcatgcgttacatctggggttct
ttagaaaccaaaataccgtcccaatttctccaggaattaccaccggatttattggccgat
ggctcaactggtcgtagaactggtcgcaatgctcctgccgccgatcccaagggaccttcc
attgcccaaaaacaagcccgaaaaaaaactggttcccagtccactcaaccggctaaagac
ctaatctggaatgttggcgatcgggtaatgcacaacaattttggagaaggcactgtgacc
cacattttaggcaaaggccataaagctaatttggccatcaaatttcccggcattggtgtg
aaaattattgaccccagtttcgcccctctacgccgcctttga

DBGET integrated database retrieval system