KEGG   Tolumonas auensis: Tola_2433
Entry
Tola_2433         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: ACQ94028
UniProt: C4L9S5
Position
2657994..2660183
AA seq 729 aa
MSQTQPVEVLLRPAVELYTVAVCAGAAFLCLVAPWSLALSPAMGIGSALAFATFGAIRWR
DAQVILRYRRNIRRLPRYVMTSRDVPVSQQRLFIGKGFRWEQKHTHRLMQTYRPEFRRYV
EPTPAYQLARRLEERLEFAPFPLSRLSSLTSWDMPLNPVRPLPPVGGLPRLHGIEPEEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRQNAAGEHEVVIVIDPKGDADLLKR
VYVEAKRAGRENELYIFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAAHFFARTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKVAQLLAPNYSDLGDPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPWASANTKVPINVHADEFNELMGDEFIPMINKGGGAGLQITAY
TQTLSDIEARIGNRAKAGQVVGNFNNVFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSEIRGSTDFTSNTQDRISMSSVPMIEPSHVVALPKGQCFALMQGGQLWKVRMPLPAAD
PDEAMPEDLQQLAGYMRQHYTEAAHWWENLGSPMLQDGPLPDDLLDEAPIASDPPANVTG
DTGLDEHTP
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgcagacgcagcccgtcgaagttctgctgcgccccgcggtggagctgtacaccgtg
gcggtctgcgccggcgccgcgtttctgtgcctggtggcaccgtggtcgctcgcgctgagc
ccggccatgggtatcggcagtgcgctggcgttcgccaccttcggtgcgatccgctggcgc
gacgcgcaggtgattctgcgttatcgccgcaacatccgcaggttgccgcgctacgtcatg
acaagccgcgacgtgccggtcagccagcagcggttattcatcggcaaaggctttcgctgg
gaacagaagcacacgcacaggctgatgcagacgtaccggcccgagttcaggcgctacgtt
gaaccgacaccggcctaccagttggcgcggcgcctggaggaacggttggagttcgcgccg
tttccactttcgcgcctgtcgagcctcaccagctgggacatgccgctcaaccccgtgcgc
cccttgccgccagtaggcggcctgccgcgcctgcacggcatcgaacccgaggaagtcgac
gtcagcctgccgctgggcgaacgcgtcggacactctctggtgctgggcacgacacgcgtg
ggcaagacgcggctcgccgagctgttcgtgacccaggacatccggcggcaaaacgctgcg
ggcgagcatgaagtcgtcatcgtcatcgaccccaagggtgatgccgatctcctgaagcgg
gtgtacgtcgaggccaagcgcgccggccgcgagaacgagctgtatatctttcatctcggc
tggcccgatatcagcgcgcgctataacgccgtgggacggtttggccgcatcagcgaggtc
gcaacgcgcatcgccggccagctttctggcgaaggcaacagcgcggcctttcgcgaattt
gcctggagattcgtcaatgtcattgccagggcgctgatcgagctggggcaacgtccggac
tatctgttgatccagcgtcatgtgatcaacatcgatgcgctgttcatcgagtacgccgcg
catttcttcgcccgcaccgagccgaaggcctgggaagtcatcgtccagatcgaggccaag
ctcaacgagaagaacatccccaggaacatgatcggacgcgagaagcgtgtcgtggccctg
gagcagtacctcagccaggcgcgcaactacgatccggtgctcgacggcctgcgctcggcg
gtccggtacgacaagacgtatttcgacaagatcgtcgcctcgctgctgcctctgttggaa
aagctcaccagcggcaaggtcgcccagttgctggccccgaactactcggacctcggtgat
ccccgtcctattttcgattggatgcaggtgatccggaagcgcgccattgtctatgtcggc
ctggatgcgctttctgatgccgaagtcgctgcggcggtcggcaattcgatgttcagtgac
ttggtttccgtcgcaggccacatttataaacacggtatcgacgatggtctgccgtgggcc
tccgcgaacaccaaggtgccgatcaatgttcacgcggatgaattcaatgagttgatgggc
gacgagttcattccgatgatcaacaaggggggcggcgccgggctccagatcaccgcttac
acgcagaccctgagcgacatcgaggcgcgcatcggcaatagggccaaagccggtcaggtc
gtcgggaatttcaacaatgtgttcatgttgagggtgcgcgaaaccgccaccgccgaactg
ctgaccaggcagttgccgaaggtggaggtctacaccacgaccatcgtcagcggtgcgacc
gatagttcggagatccgcggttcaaccgatttcaccagcaacacgcaagaccgcatcagc
atgtccagcgtgccgatgatcgagccctctcatgtcgtagcgttgccgaagggtcaatgc
ttcgccctgatgcagggcggacagctgtggaaggtcaggatgccgctgccggcggccgac
cctgatgaggccatgccggaggatctgcagcagctcgcggggtacatgcgccagcactac
accgaggctgcgcactggtgggagaacctggggtcgccgatgctgcaggatggccccttg
cccgacgacttgctcgacgaagcgcccattgcgagcgaccctcccgcgaacgtcacgggc
gacacgggcctggatgagcacacgccatga

DBGET integrated database retrieval system