KEGG   Tribolium castaneum (red flour beetle): 655405
Entry
655405            CDS       T01046                                 

Definition
(RefSeq) stress-induced-phosphoprotein 1
  KO
K09553  stress-induced-phosphoprotein 1
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tca03110]
    655405
Chaperones and folding catalysts [BR:tca03110]
 Other chaperones and cochaperones
  Sti1 / p60
   655405
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 STI1 TPR_12 TPR_14 TPR_16 TPR_17 TPR_19 TPR_7 TPR_6 TPR_9 NARP1 TPR_10 ANAPC3 TPR_3 TPR_20 TOM20_plant TP6A_N DUF4919
Other DBs
NCBI-GeneID: 655405
NCBI-ProteinID: XP_015840059
UniProt: A0A139W9L8
Position
Un
AA seq 539 aa
MEQVAALKDKGNAALAANKFEEAIKHYTEAIKLDPSNHVLYSNRSAAFAKANNHESALED
ANKTVELKPDWAKGYSRKGAALAYLGRLDEAIATYERGLQIEPANPQLQEGLQEVKAQKT
AKGFPNPFNRPDLMEKLRGDPRTKPLLDDPNYVATLHMLKTNPNLLGQKLQDPNILTTLS
VLIGIDPGEEPMETEPVYTPPKKPEPKKEPEPDLPENKKLAKAAKEQGNEFYKKKNFEKA
IEFYNQAIEHDPTDITFYNNLAAVFFEQKDYDRCIKECERAIDIGRENRADFKLIAKSFL
RIGNAYKRLKDYQNAKIYYEKSMSEHRTPEIKTLLSDVEKIIKEEERKAYVNPELAEKEK
EIGNELFKKGDYATAVKHYTEAIKRNPEDAKLYSNRAACYTKLAAFDLGLKDCDKCVELD
PKFIKGWIRKAHILQGMQQPTKAMSAFQKALEIDPNNAEAINGYRACSIENASGSGDPEK
IRQRAMADPEVQSILRDPAMRMILEQMQNDPRALQDHLKNPDIAAKIQKLLESGLIAIH
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggaacaagtcgccgctttgaaagacaaaggcaatgccgcactggccgccaacaagttc
gaagaggcaatcaaacactacaccgaagccatcaaactcgacccctcgaaccacgtcctg
tactccaaccgttccgccgccttcgccaaagccaacaaccacgaatcggctctcgaagac
gccaacaaaacggtcgaactgaagcccgactgggccaagggctactcacggaagggggct
gccttggcatacctggggcgcctcgacgaggccatcgccacgtacgagcgcggcttgcag
atcgagcccgccaacccccagctccaggaggggctgcaggaggtcaaagcccagaaaaca
gccaaggggttccccaatcctttcaaccgacctgacctcatggagaagcttcgcggggac
ccccggaccaagcccctgctcgatgaccccaactacgtcgcgacgctccacatgctcaaa
acaaaccccaatctcctcggccagaaactacaagaccccaatattttgaccacgttgagt
gtcttgattggaatcgatccgggggaagaaccgatggagaccgaaccggtgtacacgcca
ccgaagaagcccgaaccgaagaaagaacccgagccggacttacccgagaacaagaaactg
gcgaaagcggcgaaggaacaagggaatgaattttacaaaaagaagaattttgaaaaagcg
atcgagttttataatcaggcgattgaacacgatcccaccgatatcacgttttataataat
ttggcggcggtttttttcgaacagaaggattacgatcgatgtattaaggagtgcgagagg
gctattgatatagggagggagaatagagccgattttaaattaattgcaaagtcgtttctt
aggattgggaatgcgtataagagactgaaggattatcaaaatgcgaaaatttattacgaa
aagtcaatgtccgaacataggacgcctgaaattaaaacgctgttgtccgatgttgagaag
attatcaaagaggaggaacggaaagcttatgttaatcccgaattagctgaaaaagagaag
gaaattggtaatgaattatttaagaaaggtgattacgccactgccgtcaaacactacacc
gaagccatcaaacgcaacccagaagacgccaaactgtacagtaaccgtgctgcctgttat
acaaaactagctgcctttgatcttggtttaaaagactgcgacaagtgcgttgagctcgat
ccgaaattcatcaaagggtggatccgaaaagcacacattttgcaaggaatgcaacaaccg
accaaagccatgtcagctttccaaaaagcgctcgaaatcgatccgaataatgccgaagct
attaacggatatagagcatgcagtatagaaaatgcgagcggttcaggtgatcctgaaaag
ataagacaacgtgcgatggctgatcctgaagttcagtcgattttgagagatcccgcaatg
aggatgatcttggaacagatgcaaaatgatccaagagctttgcaagaccacttaaagaat
cctgatatagctgcaaagatacaaaagttgctagagtcggggcttattgctattcattaa

DBGET integrated database retrieval system