KEGG   Tribolium castaneum (red flour beetle): 655772
Entry
655772            CDS       T01046                                 

Gene name
hif1a, sima, similar
Definition
(RefSeq) hypoxia-inducible factor 1-alpha
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04137  Mitophagy - animal
tca04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    655772 (hif1a)
   04137 Mitophagy - animal
    655772 (hif1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tca03000]
    655772 (hif1a)
Transcription factors [BR:tca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    655772 (hif1a)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9 HIF-1a_CTAD PAS_4 HLH PAS_2
Other DBs
NCBI-GeneID: 655772
NCBI-ProteinID: XP_015835862
Position
LG5
AA seq 895 aa
MKNFSTFNVTNRQLTKMECSTFPQDGVAVQQTSQMSPYLGNVNCATSYGLNNATLEPIPN
RHNSRIRPNGLLARMALPCQSSSNWDYTECYSYYADGCYNTCQFVEFGDIEDFMNNEKRK
EKSRDAARSRRSKETEVFTDLGNALPISQEQVSQLDKASVMRLAIAYLRVRDMITLVPEA
PEPDDHKILTDESIFLKALEGFLLVMSSEGDIVYMSENVSEYLGITQIDLMGQNIFEYSH
PCDHDEIKEILSTKTREETETPKSFFIRLKCTLTSKGRSVNLKSATYKVIHCTGHIVQTE
DDGNEENAKGTLRRCLVAIGQPIPHPSNIEAPLPRQTFLTKHSLDMKFTHADDKIMMDVL
GYDSEDLVGKSVYDYHHAMDSDAICSAFKCLFSKGQCETNRYRFLAKTGGYVWVLTQATL
INDNKTMKPQSVVCVNYVISGVECKDEIYSSSQLASVKTENLCNNENLPVLVEKVTPEAT
PAKKPELNNAKKVISSYVDNSTKPPLTATSKIFAPRTKEMNKGFLMFSDEEPGLTMLKDE
PDDLTHLAPVAGDVCVPLDDHPFLTDKMLDDFLLRDNFEPLLTDEPTDPFISYRDSYDNS
PQLLSPNLSKNSECSLPSLNSPSDSLSDEDRLSTFMNLHTEDESDLVAKAPYITMNMGDD
LPLLMSDDLMWSSSEKSRASPDSSSSLAQLLCSSINKHSRPNDHGGGLISPDRLMDVDEY
YNKKNSAMNGKSSSISSRLERTNKRSNTSNYESNTKRSRNEPKEKMSSELLQQLMSTNHH
RGRPKGKSNWLLDSGGQKAACISQPSDSVLMNLLDDPMDRTSVKRDKGRPPGPPDDARAR
QNTIRKNSLSLLDPDATIPSLLDLTQQDFEVNAPVNSLLLQGTDLLTALDINGPI
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgaaaaatttctccacttttaacgtcactaatcgacagttaactaaaatggagtgtagt
acttttccacaagacggtgtcgcggttcaacaaacttcacaaatgagcccttacttggga
aatgtgaattgtgcgaccagttatggattaaataatgcaacccttgaaccgattccaaat
cgacataacagtcggattagacctaatggtctcctggctcgcatggccttaccgtgccag
tcgtcctccaattgggattatacagagtgttatagttattatgcagatgggtgctataac
acttgccagtttgttgaatttggtgatattgaagacttcatgaataatgagaaacgtaag
gaaaaatccagagatgcggcgcgatctcgtcgctccaaagaaaccgaagtttttaccgac
ttgggtaacgctctgccaatttcacaagaacaggtttcgcaattggataaagcttccgtt
atgagattggccattgcatatctgcgggtgcgggatatgatcactttggtcccggaagcc
ccggagcccgacgaccacaaaattttaaccgatgaatcaattttcttgaaagcattagag
gggtttttactggtgatgtcttcagagggagacattgtttacatgtctgagaatgtcagc
gagtatcttggaattacacagattgatctgatgggtcagaatatttttgagtacagtcat
ccgtgcgatcatgacgaaatcaaggaaattttatcaacaaagacccgggaagaaacagag
acgcctaagtcgttttttatcaggcttaagtgtactcttacaagcaaaggccgatcggtc
aatctcaaatcagcgacttacaaggtcatccattgcactggtcacatagtgcaaactgaa
gatgacggaaatgaagaaaatgcgaaaggaactttgcgccgatgtcttgtggcaatagga
caacctattccgcatccttccaacatcgaagccccattaccacgtcaaacattcttaaca
aaacacagtttggatatgaaatttacgcacgctgacgataaaataatgatggatgttttg
ggatacgattcggaagatttggtcgggaaatcggtttatgactatcaccatgccatggat
agtgacgcgatttgttcagctttcaagtgtttattttccaaaggacagtgtgagaccaat
cggtaccgtttccttgcaaaaactgggggctacgtctgggtcctcacccaagccacgttg
atcaacgacaacaagaccatgaagccccaaagtgtcgtttgcgtgaactacgtcataagt
ggtgtcgaatgtaaagatgagatttactcgtcgtcgcaattggcgtcggtaaaaacagaa
aatttgtgcaataacgagaatttacccgtacttgtggagaaagtgactccggaggcgact
ccggcgaaaaagcccgagcttaataacgccaagaaagtgatttcttcctacgtggataac
agcacgaagccaccgcttacggcgacttcgaaaattttcgccccgaggactaaagagatg
aacaagggattcctgatgttctccgatgaggagccgggactcacgatgttgaaggacgag
cctgacgatttgacgcatttggctccagtagccggcgacgtttgcgttcctctagacgat
cacccctttttaaccgacaagatgttggacgatttcttgctcagagataattttgagccg
ctgcttaccgacgaacccaccgaccctttcatttcgtacagagattcctacgataattct
ccccaattattatctccgaatctctcaaagaattcggagtgtagtttaccttcgttaaat
agtccgagcgattctctaagcgacgaggatcgtttgtcaacgttcatgaatttgcacaca
gaggacgagtcggatttggtggcgaaagccccctatatcacgatgaacatgggcgacgat
ctgcccctgctgatgtcagacgatctcatgtggagcagcagcgaaaagtcgagagcttcg
cccgacagtagctcgagtctggcacagttgttgtgctcttcgataaacaaacactcgcgt
ccgaacgatcacggcggagggttgatttcgccggatcggctcatggacgtggacgaatat
tacaacaagaaaaattcagcaatgaacggaaagtcgtcgtcgatatcgtcccggttagag
cgaacaaacaaaagatcgaacacttcaaattacgagtcaaacacaaagcggtcgcgaaac
gagcctaaagagaaaatgtcttcagagcttttgcagcagttaatgtcaaccaaccaccac
cggggccgcccgaagggcaagagcaactggttgctcgactcgggcggccagaaggcggct
tgcataagccagccgagtgacagtgtcttgatgaaccttctggatgatcccatggaccgg
acgtccgtgaaaagggacaaggggcggcccccgggcccccctgacgacgccagggcgcgc
cagaacacgatacggaagaattccctgtcgctgctcgatcccgacgcgaccataccgtca
ttactcgatttgacgcaacaggatttcgaagtgaacgcacctgtgaatagcctcctcctg
caaggcaccgatctgctgacggcgcttgacatcaacgggcccatttag

DBGET integrated database retrieval system