KEGG   Tribolium castaneum (red flour beetle): 656230
Entry
656230            CDS       T01046                                 
Symbol
shf
Name
(RefSeq) shifted
  KO
K01691  WNT inhibitory factor 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    656230 (shf)
SSDB
Motif
Pfam: WIF EGF_2 EGF hEGF
Other DBs
NCBI-GeneID: 656230
NCBI-ProteinID: XP_008190892
Position
Un
AA seq 369 aa
MLLKIIAMLKLLVFAFLLTVTRVSSRNDPKNDPRNNGDLALWIDEKQVKMFSGMSMEIYA
IVNGNVLPYILDPNFEKYLPVIPSEVSYVNFTWKAGMKKYYYNFDRLQSFDESILEAPVI
SIKTKGRVPKRPKEFSILLPCLGNSSGVAPFGIGLLIESRKGKPLNGTPLRLKLRKECSQ
RSNNIKNVLYSYKELKIIDPDPECDKKCANQGWCNNEKICQCSEGYMGQYCQTALCYPQC
MNGGNCTSPGICSCPPGFQGRHCEGGICGEKCLNGGKCVQKDTCECSKGYYGPHCEYSKC
IIPCLNGGKCRGINKCRCPQGFRGDHCEIGKAKPHRSSCKLACKHGTCVDNTCVCDPGWY
GRLCHHMTM
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgctgaagataattgcaatgttgaaattgctggttttcgcctttctactgactgta
actcgtgtctcatcccgcaatgaccctaaaaacgacccccgaaataacggggacctagcc
ctatggattgacgagaaacaggtcaaaatgttcagtggtatgtcgatggaaatctacgca
attgtgaatggcaatgtactgccatacatattagatccgaactttgaaaaatacttacca
gtcataccttctgaagttagttatgttaattttacttggaaagcagggatgaagaagtat
tattataattttgatcgattacagtcatttgatgagagtattttagaagctccagtgata
tcaattaaaacaaaaggaagagtgccgaaacggcctaaagaatttagtattttattgcca
tgtttagggaacagttcaggggttgccccctttggaatagggcttttgattgaaagtaga
aagggaaaacctctcaatgggacgcctttgcgtctcaaactacgtaaagaatgttcccag
agaagtaataacataaaaaatgtcttatacagttataaagaattaaaaattatagatcct
gaccctgagtgtgataaaaaatgtgccaaccaaggctggtgcaataacgaaaaaatttgt
caatgctcagaagggtacatgggacagtactgtcaaactgcactgtgctatccgcagtgc
atgaacggcggaaactgcacttctcctggcatttgcagctgccccccgggattccaaggc
agacactgcgaaggaggtatttgcggcgagaagtgcctgaacggcgggaagtgcgtccag
aaagacacctgcgagtgctccaaaggctactacgggccccactgcgaatattccaaatgc
atcatcccttgcctcaacggcgggaaatgccgcggcatcaacaaatgccgatgtccccaa
ggattccgcggcgaccattgcgaaattggcaaggcaaaaccgcacagaagcagctgcaaa
ctggcctgcaaacacggcacctgtgtggacaacacgtgcgtttgcgacccgggatggtac
ggacgactttgccatcacatgacaatgtaa

DBGET integrated database retrieval system