KEGG   Tribolium castaneum (red flour beetle): 657832
Entry
657832            CDS       T01046                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 N
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04120  Ubiquitin mediated proteolysis
tca04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    657832
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    657832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    657832
   03400 DNA repair and recombination proteins [BR:tca03400]
    657832
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     657832
Ubiquitin system [BR:tca04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   657832
DNA repair and recombination proteins [BR:tca03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    657832
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 657832
NCBI-ProteinID: XP_969360
UniProt: D6W8B6
Position
LGX:complement(7960643..7961565)
AA seq 151 aa
MAALPRRIIKETQRLMQEPVPGISAVPDDSNARYFHVIVTGPEDSPFEGGLFKLELFLPE
DYPMSAPKVRFITKIYHPNIDRLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAELWKVNESEAIRNAKEWTRRYAMDN
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcagccttaccacgcagaattataaaagaaacgcaacgtttaatgcaagaacctgtg
cccgggattagtgcagtaccggatgacagtaacgcccggtattttcacgtaattgtgacc
ggccccgaggactccccgttcgaagggggcttgtttaagttagaattgtttcttcccgaa
gactatccaatgtcggcgccgaaagtgaggtttatcaccaaaatataccacccgaacatc
gaccggctgggcaggatttgtctagatatcctaaaggacaagtggagccccgctttacaa
atccgcacggtgttgttatcaattcaggctttgctaagtgctcctaatccggatgatccc
ctagcgaatgatgtagcggaattgtggaaagttaacgaatcggaggctattaggaacgcc
aaggagtggacccgcagatatgcaatggacaattaa

DBGET integrated database retrieval system