KEGG   Tribolium castaneum (red flour beetle): 659847
Entry
659847            CDS       T01046                                 

Definition
(RefSeq) multidrug resistance protein 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    659847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tca02000]
    659847
   04147 Exosome [BR:tca04147]
    659847
   04090 CD molecules [BR:tca04090]
    659847
Enzymes [BR:tca01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     659847
Transporters [BR:tca02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    659847
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   659847
CD molecules [BR:tca04090]
 Proteins
  659847
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase ABC_ATPase AAA_16 AAA_22 AAA_15 AAA_29 AAA_7 AAA AAA_21 Rad17 G-alpha AAA_5 Zeta_toxin AAA_14 SbcCD_C ATP-synt_ab AAA_23 AAA_18 NB-ARC Mg_chelatase Sterol-sensing DUF962
Other DBs
NCBI-GeneID: 659847
NCBI-ProteinID: XP_008191266
UniProt: D6WES5
Position
LG3
AA seq 1263 aa
MGKKAYDLESSEKNGKKDALTPEFVQEPSEKLEKAPPVGFFKLFRYATKWDTFLMIIAVF
ASIGTGILQPLNTLLFGDLTGTIVDYVFTINSNETSEEQKQNATDVFIDGITDFAVYNTL
IGVGMLVLSYISTEFFNYTALKQVFKVRTLYLEKVFNQDISWYDVNNTGDFSSRMSDDLS
KFEDGIGEKVPMFVHFQATFLASLIMALVKGWQLALICLVSLPLSMIAIGIIAVLTSKLA
KKEQDAYGSAGSIAEEVLTSIRTVIAFGGQHKEITRYDEELEFAKKNNIKRQSMTAIGFG
LLWFFIYGSYALAFWYGVKLVLEDRNKPAKDKVYDPGTMVTVFFSVMTGSMNFGISSPYI
EAFGVARAAASKVYQIIDNIPKINLSKGNGDKIDNLKGDIKFRNVRFVYPSRQDVPILLG
LDLDIKAGQTVALVGSSGCGKSTCIQLIQRFYDPLEGEVSLDGKNLKDFDLTWLRNNIGV
VGQEPVLFATTIAENIRYGNSKATDEEIKNAAIKANAHEFIKKLPSGYDTLVGERGAQLS
GGQKQRIAIARALVRNPAILLLDEATSALDTNSEAKVQAALDKASKGCTTVIVAHRLSTI
RNANKIVVISKGKVVEQGTHNELMELKSEYYNLVMTQVSAVEKFDGDQEGESRKLVELER
QVSLLDDEKHDDAEEEVQEAERSVSLMSILRMNKPEWVSISIGCIASIVMGCSMPAFAVI
FGDIMGVLAEKNEDEVISETNRFCIYFVIAGVVSGIATFLQIFMFSVAGEKLTMRLRSMT
FIAMLKQEMGWYDRKDNGVGALCARLSGEAAHVQGATGQRVGTILQSIATIGLSVGLSMY
YQWKLGLVALAFTPFILLAVFFQHRLMNVENEAHHKSLQKSNKLAVEAVGNVRTVVSLGL
EETFHKLYISYLMEHHKRTLRNTHFRAVVLGLARSIMFFAYSACMYYGGHLIRDEGLLYQ
DVFKVSQSLIMGTVSIANALAFTPNLQKGLVAAARIIRLLRRQPLIRDEPGAKDKEWENG
AIQYDTIYFSYPTRPNIMVLKGLNLSVLQGKTVALVGPSGCGKSTIIQLIERFYDPLEGT
LTVDNEDIRNIRLGSHRSHLGIVSQEPNLFDRTIGDNIAYGDNSREVTQEEIIEAAKNAN
IHNFIASLPLGYETRLGEKGTQLSGGQKQRVAIARALVRNPKLLLLDEATSALDSESEKV
VQEALDNAKKGRTCITIAHRLTTIQDADVICVIDKGVVAEIGTHSELLSQKGLYYKLHSL
QNK
NT seq 3792 nt   +upstreamnt  +downstreamnt
atggggaagaaagcgtacgatttggaatcaagcgaaaaaaatggaaaaaaagacgcccta
acgcccgaatttgtacaagaaccaagcgaaaaactggaaaaagcacctcctgttggattc
tttaaactatttcgctatgccacaaaatgggacacatttctgatgatcattgcggttttt
gcatccattggcactggaattttgcaacctttaaacacacttttgtttggagacttgaca
ggaaccatcgtcgattatgtcttcaccattaattcaaatgaaaccagcgaggaacaaaaa
caaaacgcgactgatgtttttatcgacggaatcacagattttgcagtctataacacctta
ataggggttggaatgctagttttgagttatatttcaacagagttcttcaactacactgcc
ctgaaacaagtttttaaagtacgaacattatatctagaaaaagtattcaatcaagacatt
tcgtggtacgatgtcaataatactggggatttttcgagccgaatgtcagacgatctctcg
aaatttgaggacggaattggggaaaaagtcccaatgtttgtccatttccaagccactttc
ctggcctctctgatcatggctttggtcaaaggttggcaacttgccctcatctgtctcgtc
tcgctacccttgtccatgattgcaattggaatcatcgcagtgttgacatcaaaacttgca
aaaaaagagcaagacgcgtacggttctgccggttcaatcgccgaagaagtcttgacttca
attcgaacagttatagctttcggaggacaacacaaagaaataacacgctatgacgaagag
ttggagtttgcaaagaagaacaatatcaaaagacagtccatgacagcgattggtttcggt
ctattgtggtttttcatctatggcagttacgctcttgcgttttggtatggagttaagttg
gttctagaagacagaaacaaaccagccaaggacaaagtctacgatcctggtaccatggtc
actgtgtttttcagtgtgatgactggtagtatgaatttcggaatttcctcaccgtatatt
gaagcgtttggtgttgcaagagctgcagccagcaaagtttaccaaatcattgacaacatt
cccaaaatcaatctatcgaaaggcaatggagataaaattgataatctcaagggagacatt
aaatttaggaacgttcggtttgtgtatccctccagacaagatgttccaattttgctaggt
ctggatttggacatcaaagctggccaaactgttgctttggttggcagttcgggttgtgga
aaatcgacttgtatccaactgatccagcgtttttatgaccctcttgaaggagaggtgagt
ctggacggaaaaaacttgaaagactttgacttgacttggctgaggaacaacattggtgtc
gtgggccaggagccagttctcttcgctaccacaatagccgagaacattcgttacggcaac
agcaaagccacagacgaagaaatcaaaaacgccgcaatcaaagccaacgctcacgaattt
atcaaaaaactcccctcaggttacgacactttagttggtgaaagaggagcgcaattgtcc
ggagggcaaaaacaaagaattgcgatcgctagagctcttgtcagaaatcctgcgattctg
ctcttggacgaagcaacttcggctctggatacgaacagcgaggctaaagttcaagccgct
ttggataaagctagtaaaggttgtacgactgttattgtggctcatcggttgtcgacgatt
cgaaatgccaataaaattgttgtgatatcgaaggggaaagttgtggagcagggaactcat
aacgagttgatggaacttaaaagcgagtattataatctggttatgacgcaagtaagtgct
gtggagaagtttgatggggatcaggaaggtgaaagtaggaagttagtggagctggaaagg
caggtttcgcttctggatgacgaaaagcacgacgatgctgaggaagaagtccaagaagcc
gaaagatccgtatcgctcatgtcaatattaagaatgaacaaaccagaatgggtctcaatt
tccatcggctgcatcgcttccatcgtgatgggttgttccatgccggcgtttgctgtcata
ttcggtgatattatgggggttttagctgagaaaaacgaagacgaagttatttctgaaacc
aaccgtttctgcatctactttgtgattgctggagttgtttctggaatcgcaacgttttta
caaatatttatgtttagtgtcgctggtgaaaaactaacaatgaggcttcgcagcatgaca
ttcatagcaatgttaaagcaagagatgggctggtatgatagaaaagataacggagttggc
gccctttgtgctagattatctggtgaagcggcacatgtccaaggagcgactggtcaaaga
gttggaacaattttacaatcgattgccacaattggtttatcagtgggtctctcaatgtac
taccagtggaaattgggacttgtggcgttggcttttacgccttttatcctccttgctgtt
ttcttccaacacagattaatgaacgtcgaaaatgaagctcatcacaagtccttacaaaaa
tctaacaaacttgcagttgaagcggtaggtaatgtgcgtaccgtagtgtcgttagggctc
gaagaaactttccacaagctttacatctcgtatctgatggaacaccacaaaagaacacta
agaaatacacattttcgtgccgtggtgttaggtctagcccggagtataatgttctttgct
tattctgcttgtatgtattacggtggtcatcttattcgagacgaaggattactatatcag
gatgtttttaaagtatcacagtcacttattatgggtacggtatcaatcgccaatgctcta
gcgtttacaccaaatctccaaaaaggtctagtagcagctgctagaatcataaggttgctc
aggcgacaaccactcatcagggatgaacccggtgctaaagataaagaatgggaaaacggt
gccatccaatatgacaccatatacttctcgtacccaacccgtccaaacatcatggtcctc
aaaggcctaaatttgtccgtattgcaaggaaaaactgtagccctagtcggccctagcggc
tgtggaaaatcgacaataatccaactaattgaacgattttacgaccctcttgaaggcact
cttacagtagacaacgaagatatcagaaacatccgactaggatcgcatcgttcccacttg
ggaatagtctcgcaagagccaaatcttttcgatagaaccatcggcgacaacatcgcttat
ggtgacaattccagggaagtgactcaagaagaaataatagaagctgccaaaaacgcaaac
atacacaatttcatcgcttcgttacctttgggttatgaaactcgtcttggtgaaaaagga
acacaattgtcaggtggccagaaacagagagttgctatcgctagagctttggttagaaat
ccgaaattattgcttttggacgaagcgacaagtgctttagattccgaaagtgaaaaggtt
gtgcaagaagctttagataatgcaaagaagggaagaacttgtatcacaatagcccacaga
ctgacaaccattcaagatgctgatgttatttgtgtgatagacaagggtgtggtggcagaa
attggaacacattccgaacttttgagccagaagggactctactacaaattgcattcgctc
cagaacaaatag

DBGET integrated database retrieval system