KEGG   Tribolium castaneum (red flour beetle): 660676
Entry
660676            CDS       T01046                                 

Definition
(RefSeq) rab GTPase-binding effector protein 1
  KO
K12480  Rab GTPase-binding effector protein 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    660676
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    660676
Membrane trafficking [BR:tca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    660676
 Protein recycling
   Rab4 associated proteins
    660676
SSDB
Motif
Pfam: Rab5-bind FYVE Rabaptin IBR DUF5082 HypA VHL_C
Other DBs
NCBI-GeneID: 660676
NCBI-ProteinID: XP_008197246
Position
LG8
AA seq 640 aa
MEVGEVSENPEDKIGQLEAEKKRIQDEFNMQRAKMKELFLQKEDELLRRNHENARLNSEI
EELKRELDDLKSQLVVAGMTLENSFEQEKRKANEEIATLQQLVHETVEESSSSRSLYDSE
LKNLQTYIQQLQNEILVLKQQKQQSPHHSSQESSLAPSVVLNALTKGIAKKLGADAFAAS
QDSGDDPARKVETSDHAQEDPEVLRSLIGPLEDQIQALKEKLRATDEQLQRCRECGHSQD
KNDQNVSTNTSFDSPKHATSCDMCSNYEDQLVAEQRKTKELELKVQKAEKAAERHKEDLL
KEIGFRKEIEEKWNEKKEEHKQQVAELTRSTECAEQDLKELRQVFSQTCAEMSEMLKKLT
KGREKVQEELTNLQKENDNLVGKYTIHSQELQSEAINLPNTVEELHELVLKHHQDLIIAK
IGKEAAEEKVNTLQSDILLLRDQITNDQHEKEVIENNLAQEIDLLKKQKHQLEKEKKLYL
ANQEKLQNTDKANLAQIAELQKQIHELQTIKRQLEDQNSELRTRVSSLQQELDTSETVQK
DFVRLSQSLQMQLEKIRESDTQVRWQHEEDVEQCPNCRSDFGGPKRKEHCRHCGQIFCTS
CLTRTVESGASMLPSKVCDVCHTLLVKSSAPYFSEAPPMT
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggaagtgggtgaagtctccgaaaatccggaagacaaaatcgggcaattggaggccgaa
aagaagcgaatccaggatgagttcaacatgcaaagggccaaaatgaaagaactgttcttg
caaaaagaagatgaactgttacgcagaaatcacgaaaacgcacgcttaaattccgaaatc
gaagagttaaagcgcgaattggacgatttgaaaagtcagttagttgtggcagggatgacc
cttgagaatagttttgagcaggagaaacgtaaagccaacgaggaaattgcaacgttacaa
caactagttcacgaaaccgtggaagagtccagctctagtcggagtttgtacgacagcgag
cttaaaaacttacaaacgtatatccagcaattacaaaacgagattttagtcctgaagcag
caaaagcaacagtcgccccaccattccagccaggagtctagtctggctcctagtgtcgtc
cttaacgccctaactaaaggaatagctaaaaaattgggagctgacgcgttcgctgcctct
caagacagtggcgatgaccccgccagaaaggtagagaccagcgaccatgcccaggaggac
cccgaggtgctgcgctcgctcattggcccccttgaggaccagatccaggccctcaaggaa
aagctgcgcgcgactgacgaacagctacaaaggtgtcgcgagtgtggccacagccaggac
aaaaacgaccagaatgtttcgacaaacacgtcgttcgattcgccgaaacatgccacttcg
tgcgacatgtgcagcaattacgaggaccagttggtggccgaacagcgcaaaacgaaagag
ttggaactgaaagtacaaaaggcggaaaaggcggccgaaagacacaaggaggatttgctc
aaggagatcggcttccggaaggagatcgaggagaagtggaacgagaaaaaggaggaacat
aagcagcaagtggccgaactgacccggagcacggaatgtgccgagcaggacttgaaggag
ttgcggcaggtttttagccagacatgcgccgaaatgagcgaaatgttgaagaaattgacc
aaagggcgggagaaagtccaggaggaattaaccaatctccaaaaggagaacgataatttg
gtcgggaagtacacaattcactcacaagagctgcagagtgaagcgattaatctcccgaat
actgttgaggagcttcacgagttggtgctaaagcaccaccaggatttgattatagccaag
atcgggaaggaggcggctgaggaaaaagtcaatactttgcagtcggatattttattgttg
cgagatcagattaccaacgaccaacacgagaaggaagttattgagaataatctggcacaa
gaaattgatttgttgaagaagcagaaacatcagttagagaaggagaaaaagttgtatttg
gccaatcaggagaagttgcaaaacacggataaggccaatttggcacaaattgcagagctg
cagaagcaaatacacgagctgcaaacaatcaaacgccagctggaagaccagaacagcgag
ctccgcacgcgcgtctcctccctgcagcaggagctcgacacgagcgaaacggtccagaaa
gacttcgtgcgtttatcgcaaagcttgcagatgcaattggagaaaatccgcgagtccgac
acccaagtccgatggcagcacgaagaagacgtcgagcagtgccccaactgtcgctccgac
ttcggcggccccaaacgcaaggagcactgtcgacactgcggccagatcttctgcacctcg
tgtctcaccagaactgtggaaagtggggctagcatgctcccgtcaaaggtttgtgatgtc
tgtcatactttactagtcaaatcgtcggcgccctacttcagcgaagcgcccccgatgact
taa

DBGET integrated database retrieval system