KEGG   Tribolium castaneum (red flour beetle): 661872
Entry
661872            CDS       T01046                                 
Name
(RefSeq) disintegrin and metalloproteinase domain-containing protein 10
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    661872
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tca04090]
    661872
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     661872
Peptidases and inhibitors [BR:tca01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   661872
CD molecules [BR:tca04090]
 Proteins
  661872
SSDB
Motif
Pfam: Reprolysin_5 Reprolysin_2 Reprolysin_3 Disintegrin Pep_M12B_propep Reprolysin Reprolysin_4
Other DBs
NCBI-GeneID: 661872
NCBI-ProteinID: XP_973097
UniProt: A0A139WMP5
Position
LG2:complement(11765477..11815118)
AA seq 1090 aa
MLMQEVVCGVVLVFTSAIVYLSASPLDPVRHMKDFDLNSWIRYYEPAHYDPHSLVVQHNR
VRRSVGQKQPHQVQLDIKGRDRLFKIRLIPDNDVFADDVSFESTRGQIHLDPNFVYTGVL
EDDDSASVLGIITKEGLFEGTISTAIEDYHVEPVSRYLRPNETKQPSSFHSIVYKSSDVR
DPRQGVPCASHRLHLNNLGKNTADRENYPERRSKRWLLEAEAKLPYDDSTFWHLNKTKHS
FSPAYDLNQPIDEELDLITSNRSNGDFPGIIFRNVNKRATIDPKKTTCMLYLQADHQFFQ
KYGTEEACIEVMTRHVQRVNAIYKATDFNQDGKADNITFMVKRIKVHTTDALRDPLYRFP
NNYGVEKFLELFSEEDYDAFCLAYMFTYRDFEMGTLGLAWTGDLKNAGGVCEKNGHYRGS
MKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPEQCTPGGEDGNFIMFARAT
SGDKKNNNQFSPCSLKSINPVLNFKARSPKGCFTEPQASLCGNGVVEEGEECDCGWEEDC
RDQCCFPQRRYPPLDEPPCRLTPRSICSPSQGPCCTSECQVKFGDKCRDDNGCRDESFCN
GRNPQCPPSVNKPNKTICNKEFVCFMGECTGSICLAYGLESCQCIPKKGDPKTKACELCC
KLPGDNQPCLSSFDWNDMPYDIPDMYSKPGTPCNDYSGYCDVFQMCREVDPSGPLATLRK
LLLSEESFASFKKWMMDYWYAVAAIVALVVALLVLSTKYLSKKPNLKLKSITIMHSSPTE
AVRLPPDGENGQVTVHPAIRSKLPLKRKVRNGKIKRKRKTKESLNNNLNSPSRTKNSPKK
KKRVSAAVGAEERKKPVVDAAIIEIPHSKVKKSPQVTANKKKKKKKETIDYSNAQPDVEG
KKLISAEVVHNPLTPEADPVGKVQNWLLKSQYALPKSKSTPAGLTDKSRRSPHKRPTIRP
RTDKSKSHSVGNIPSEKEKVRLQVVYKPPFKFSVKLRKPEKTSVVIENVNRKTEKSKTPR
TGVLVRSVKQREPKTSVDNPAVAIDATPVASPLQVVDSPAKPDDIDSNIHTVQSDLEVLL
SESEFLFSDD
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgttgatgcaagaagttgtgtgcggtgttgtgctcgtgttcacctcggctattgtatac
ctgtctgcttcaccgttagatccagtgcggcatatgaaagatttcgacttgaactcctgg
ataagatattacgagccggcccattacgacccccattctttggtcgtccaacacaaccgt
gtccggagaagtgtcggtcagaaacaaccacaccaagtccaattggacattaaaggacga
gatcggttgtttaagattcgactaattccggataacgacgtgttcgctgacgacgtttcc
ttcgaatcaacgagaggacagattcatttggacccgaatttcgtctacaccggagtcctt
gaagatgacgattcagcttcggtcctcgggatcatcacaaaagaggggctcttcgagggc
acaatttcgacggctatcgaggattaccacgtagaacccgtcagccgttacctccgaccc
aacgaaacgaaacagccctcttcatttcactccatcgtgtacaaatcgtccgacgttcga
gacccccgtcagggtgtgccgtgcgcctcccaccgcttgcatttaaacaatttagggaaa
aacaccgccgatagagaaaattacccggaacggaggagtaaaagatggcttttagaggcc
gaagccaaactgccctacgatgactccactttctggcatctcaacaaaacgaaacattct
ttttcgccggcctacgacctaaatcagcccattgatgaggagcttgacttaattacgagc
aatcgctctaatggcgattttccgggcattattttccgaaacgtcaataaaagggccacc
atcgatcccaaaaagacaacctgcatgctgtacctccaagcagaccaccagttttttcaa
aagtacggcactgaggaggcctgcatcgaggtcatgacccgacacgtccaacgcgtaaat
gccatctataaagccacagatttcaaccaggacggtaaagcagacaatataacttttatg
gtgaaacgaattaaagtgcacacgactgacgccctcagggatcccctctacagatttccc
aacaattacggcgtcgaaaaattcctggaactcttctcagaggaggactacgatgcattc
tgtttagcctacatgtttacttatcgtgatttcgaaatgggaacgttgggtttggcctgg
actggagatttgaaaaatgcgggcggcgtttgcgagaagaacgggcactacagaggaagc
atgaagtccttaaatacaggaatcgtaacgttgttgaactacggaaaacacgtaccgcct
gcggtgtcccatgtaacacttgctcacgaaatcggacataattttgggtcaccgcacgac
ccggaacagtgcacccccggaggcgaagatggtaactttattatgttcgcaagggcgacg
tcaggtgacaagaaaaacaataatcagttttccccgtgcagtctgaagagcattaaccca
gtacttaattttaaagcgcgctcaccaaaaggatgtttcacagaacctcaagcctccctc
tgtggcaacggcgtcgtcgaagagggcgaagagtgcgactgtggctgggaggaggactgt
cgggaccagtgctgcttcccccagcggaggtacccgcccctagacgagcccccgtgccgc
ctcacgccgcgcagcatctgcagcccctcgcaggggccgtgctgcacgtccgagtgccaa
gtgaagttcggcgataagtgtcgggacgacaacggctgcagagacgaaagtttctgcaac
gggcgcaacccgcagtgtcccccgtcagtgaacaagccgaacaagacaatttgcaataaa
gagtttgtttgtttcatgggcgaatgcaccggatctatatgtttggcgtatggcctggaa
tcttgccaatgcattccgaagaagggtgacccaaaaaccaaagcatgcgaattgtgctgt
aaacttccaggggataatcagccgtgtctttcttcgtttgattggaacgacatgccttat
gacattcccgacatgtattcaaaaccaggaacgccctgcaacgactacagcggatactgc
gacgtatttcaaatgtgcagagaagttgatccttcgggacccttggctacgctgcgaaaa
ttgctcctgtcggaggaaagcttcgcaagctttaaaaagtggatgatggactattggtat
gcggtggccgccatcgtggccctcgttgttgcgctgctggtgttaagcaccaagtacctc
agtaagaagccaaatctgaaattgaaatcgatcacaataatgcacagttcgccgactgaa
gccgttcgcttgcctccagacggagaaaacgggcaagtaactgtgcacccggcaattaga
tcaaagctacctctaaaacgtaaagtccgcaacggcaaaatcaaacgcaaacgcaagact
aaggaatcactaaacaacaatttgaatagccctagtaggacgaagaattctcctaagaaa
aagaaacgcgtttctgcagcggttggtgcagaagagcgcaagaagccggtagtggacgct
gcaataatcgaaatacctcacagcaaagtcaaaaagtcgccgcaagtgaccgccaacaag
aagaagaagaagaaaaaggaaactatagattatagtaacgcccaaccggacgtcgaggga
aagaaactgattagtgccgaagttgtgcataatccgttgactcctgaggcagatccggtg
ggtaaagtccagaattggttgttgaagtcacaatacgccttgccgaagtccaaatcgacg
ccagcgggactaaccgacaagtcccgaagaagtccccacaaacgtcccacgattcggcct
cgcaccgacaagagcaaatcgcacagtgtgggcaacattcctagtgagaaggaaaaagtc
cgattgcaagtagtgtataaaccgccgtttaaatttagtgttaagttgcgtaaaccggaa
aaaactagtgtcgttattgagaacgtgaacagaaagactgaaaaaagtaaaactccgagg
acaggtgtgcttgtgcgtagtgtgaaacagcgcgagccgaagacgagtgtcgataatcca
gctgttgcgattgacgcaacgcccgtagctagtccgttgcaggttgttgattctcccgct
aaacctgatgatattgattccaatattcataccgtccagtctgatttagaagtattgttg
tctgaaagcgaatttctattttcagatgactga

DBGET integrated database retrieval system