KEGG   Tribolium castaneum (red flour beetle): 664493
Entry
664493            CDS       T01046                                 
Name
(RefSeq) ras-like protein 2
  KO
K07830  Ras-related protein R-Ras2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04137  Mitophagy - animal
tca04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    664493
   04137 Mitophagy - animal
    664493
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    664493
   04031 GTP-binding proteins [BR:tca04031]
    664493
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   664493
  Exosomal proteins of bladder cancer cells
   664493
GTP-binding proteins [BR:tca04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    664493
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase FeoB_N MMR_HSR1_Xtn DUF2075 NPHI_C
Other DBs
NCBI-GeneID: 664493
NCBI-ProteinID: XP_008195985
UniProt: D6WRL7
Position
LG7:10016979..10018926
AA seq 200 aa
MSKVTDRPNSYQTYKLVIVGGGGVGKSAITLQFIQSYFVTDYDPTIEDSYTKQCVIDDIP
AKLDILDTAGQEEFSAMREQYMRSGEGFLLVFSVTERSSFEEVYKFHKQILRVKDRDEFP
MLMVGNKVDLEHQRVVWQEEAQQLARQLKIPYIECSAKMRMNVDNAFYELVRVVRKFQLS
ERPPLKTGYMKRNKKKCCML
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtctaaggtaacggacaggcccaacagttatcagacgtacaaattggttattgtgggt
ggaggtggtgtcggaaagtccgcaataactttgcaatttatccagagctacttcgttacc
gactacgaccccaccattgaggactcttacaccaaacaatgtgtcatcgacgatatcccc
gcaaaactagacattttggacaccgccggtcaggaggaattcagcgccatgcgggaacaa
tacatgagatcgggtgaaggcttcttgctcgtcttttcagtaacagaaaggtccagcttc
gaggaagtgtacaaattccacaaacagatccttagagtgaaggaccgcgacgagttcccc
atgctgatggtgggaaacaaggtggatctggagcaccagcgagtcgtttggcaagaggag
gcgcagcagctggccagacaattaaaaatcccgtacattgaatgcagtgccaaaatgagg
atgaatgtggataatgccttctacgaactggtccgcgttgtgcgaaaattccagttatcg
gaaagaccgcctctaaagaccggctacatgaaaaggaacaagaaaaaatgctgcatgctg
tga

DBGET integrated database retrieval system