KEGG   Taeniopygia guttata (zebra finch): 100218346
Entry
100218346         CDS       T01082                                 
Symbol
EPHB2
Name
(RefSeq) ephrin type-B receptor 2 isoform X1
  KO
K05111  Eph receptor B2 [EC:2.7.10.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgu01001]
    100218346 (EPHB2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100218346 (EPHB2)
Protein kinases [BR:tgu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100218346 (EPHB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N ABC1 SusE DUF4998 Kdo TMEM154 cEGF Haspin_kinase
Other DBs
NCBI-GeneID: 100218346
NCBI-ProteinID: XP_030144978
Position
21:complement(6957394..7096162)
AA seq 995 aa
MPGPARTMGPLWLCCLPLALLPLLAAVEETLMDSTTATAELGWTVHPPSGWEEVSGYDEN
MNTIRTYQVCNVFESSQNNWLRTKYIRRRGAHRIHVEMKFSVRDCSSIPNVPGSCKETFN
LYYFESDFDSATKTFPNWMENPWMKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKN
GFYLAFQDYGGCMSLIAVRVFYRKCPRVIQNGAVFQETLSGAESTSLVAARGTCIANAEE
VDVPIKLYCNGDGEWLVPIGRCMCRAGYESVENGTVCRGCPSGTFKASQGDEGCVHCPIN
SRTTSEGATNCVCRNGYYRADADPVDMPCTTIPSAPQAVISSVNETSLMLEWSPPRDSGG
REDLVYNIICKSCGAGRGACTRCGDNVQFAPRQLGLTEPRIYISDLLAHTQYTFEIQAVN
GVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQ
YYEKDLSELNSTTVKSPTNTVAVQNLKAGTIYVFQVRARTVAGYGRYSGKMYFQTMTEAE
YQTSVQEKLPLIVGSSAAGLVFLIAVVVIGIVCSRRRGFERADSEYTDKLQHYTSGHMTP
GMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVA
IKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFL
RQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFL
EDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMT
NQDVINAIEQDYRLPPPMDCPNALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLK
AMAPLSSGMNLPLLDRTIPDYTSFNTVDEWLDAIKMSQYKESFASAGFTTFDVVSQMTVE
DILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgcccggcccggcgcgcaccatggggccgctgtggctctgctgcctgcccctcgccctc
ctgcccctgctcgccgccgtggaagagacactgatggactccaccacggcgacagcagag
ctgggctggaccgtgcatcctccctcagggtgggaagaggtgagtgggtacgacgagaac
atgaacacgatccgcacctaccaggtgtgcaacgtctttgaatccagccagaacaactgg
ctccggaccaagtacatccggaggcgaggagcacaccgcatccacgtggagatgaaattt
tctgtgcgggactgcagcagcatccccaatgtcccaggctcctgtaaggagacttttaac
ctctactatttcgagtcagacttcgactcggccaccaagacttttcctaactggatggag
aatccttggatgaaggtggacacaattgctgctgatgagagcttctcacaggtggactta
ggtggacgggtgatgaagatcaacactgaggtgcgcagttttgggcctgtctccaagaat
ggtttctacctggccttccaggactatgggggctgcatgtccctgattgccgtccgtgtc
ttctaccgcaaatgtccccgtgtgatccagaacggggccgtcttccaagaaaccctgtcg
ggagcagagagcacctcgctggtggcagccaggggcacgtgcattgccaatgccgaggag
gtggacgtgcccatcaagctgtactgcaacggggacggcgagtggctggtgcccatcggc
cgctgcatgtgccgggccggctacgagtcggtggagaacgggaccgtctgcagaggctgc
ccctcgggaacattcaaggccagccagggggatgaagggtgtgtccactgccccatcaac
agccggacaacctcggaaggggccacaaactgcgtgtgccgaaatggatattaccgggca
gacgccgaccctgtggacatgccatgcaccaccatcccatccgccccccaggccgtgatc
tccagcgtgaacgagacgtcgctgatgctggagtggagcccgccgcgggactcggggggc
cgggaggacctggtgtacaacatcatctgcaagagctgcggggcgggccgcggggcctgc
acgcgctgcggggacaacgtgcagttcgccccgcgccagctgggcctcaccgagcctcgc
atctacatcagcgacctgctggcacacacccagtacaccttcgagatccaggccgtcaac
ggcgtcaccgaccagagccccttctccccgcagttcgcttccgtcaacatcaccaccaac
caggccgccccttctgctgtgtccatcatgcaccaggtgagccgcaccgtggacagcatc
accctctcctggtcccagcccgaccagcccaatggagtcatcctggactatgagctgcag
tattacgagaaggatctgagcgagttgaactccaccacggtgaagagccccaccaacacg
gtggcagtgcagaacctcaaggctggcaccatctacgtgttccaggtgcgggcgcgcacc
gtggccggctacggccgctacagtggcaagatgtatttccagaccatgactgaagccgag
taccagaccagcgtgcaggagaagctgccgctcatcgtgggctcctcggcggcagggctg
gtgttcctcatcgccgtggtggtcatcggcatcgtgtgcagcagaagacggggcttcgag
cgcgctgactcggagtacacggacaagctgcagcactacaccagcggccacatgactcca
gggatgaagatttatattgatcctttcacctacgaagatcccaatgaggctgtcagggaa
tttgcaaaagaaatcgatatctcttgtgtcaaaattgagcaggtgattggggcaggggag
tttggtgaggtgtgcagtgggcatctcaagcttccaggcaaaagagagatctttgtggcc
atcaagaccctcaaatctggctacacggagaagcagaggcgagacttcctgagtgaggcc
agcatcatggggcaattcgaccaccccaacgtcatccacctggagggggtggtcaccaag
agctctccagtcatgatcatcactgagttcatggagaatggctcactggactccttccta
cggcaaaacgacgggcagttcacggtgatccagctggtggggatgctgcggggcatcgct
gcgggcatgaagtacctggcggacatgaactacgtgcatcgggacctggccgcccgcaac
atcctggtcaacagcaacctggtgtgcaaggtgtccgacttcggcctctcccgcttcctg
gaggacgacacctccgaccccacctacaccagcgccctgggtgggaagatcccgatccga
tggacggcgcctgaggccattcagtaccgaaagttcacctcggccagcgacgtgtggagc
tatggaatagtcatgtgggaggtgatgtcctacggagagcggccctactgggacatgacc
aaccaggatgtgataaacgccatcgagcaggactatcggctgccaccacccatggactgc
ccaaatgcccttcaccagctgatgcttgactgttggcagaaggatcggaaccacaggccc
aaatttgggcaaattgtcaacaccttggataaaatgatccgaaatcccaacagcctgaaa
gccatggcacctctgtcctctgggatgaacctccccctccttgaccgcacaatcccggat
tacaccagcttcaacactgtggatgaatggctggatgccatcaagatgagccagtacaag
gagagctttgccagcgctggcttcaccacttttgatgtagtatctcagatgactgtagag
gacattctgcgagttggggtcactttagcaggacaccagaagaaaattctgaacagtatc
caggtgatgagagcacagatgaaccaaatccagtctgtggaggtttga

DBGET integrated database retrieval system