KEGG   Taeniopygia guttata (zebra finch): 100222905
Entry
100222905         CDS       T01082                                 
Symbol
NCAM2
Name
(RefSeq) neural cell adhesion molecule 2 isoform X1
  KO
K06491  neural cell adhesion molecule
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu03265  Virion - Lyssavirus
tgu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03265 Virion - Lyssavirus
    100222905 (NCAM2)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100222905 (NCAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100222905 (NCAM2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tgu04515]
    100222905 (NCAM2)
   04090 CD molecules [BR:tgu04090]
    100222905 (NCAM2)
   00536 Glycosaminoglycan binding proteins [BR:tgu00536]
    100222905 (NCAM2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tgu00537]
    100222905 (NCAM2)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    100222905 (NCAM2)
Cell adhesion molecules [BR:tgu04515]
 Immunoglobulin superfamily
  NCAM1/2
   100222905 (NCAM2)
CD molecules [BR:tgu04090]
 Proteins
  100222905 (NCAM2)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   100222905 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tgu00537]
 Others
  100222905 (NCAM2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_C17orf99 Ig_6 Ig_5 Izumo-Ig Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100222905
NCBI-ProteinID: XP_002186903
Position
1:complement(5974814..6244953)
AA seq 836 aa
MSLLPLYLLGLLLGSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKI
VSSQRVVVQKEGVRSRLTIYNANIEDAGIYRCQAADAKGQTQEATVVLEIYQKLTFRDIV
SPQEFRQGEDAEVVCRVTSSPAPIVSWLYRNEEVTTIADNRFAVLANNNLQILKINKSDE
GVYRCEGRVEARGEIDFRDIIVIVNVPPAIILLQKSFNATADRGEAITLFCRATGSPPPE
ISWYRNGKLVEENEKYVLRGSNTQLTIRDIKNIDAGPYICNAKNKAGNDKQQTVLQVFVQ
PQIIQLKNETTFENGKATLICEAEGEPVPEITWKRAIDGMTFSEGDKSPDGRIEVKGQHG
KSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPTFVSNQTMYYSWEGNPINIS
CEVLANPSASVQWKRGKLVLPVKNTTHLKTYSTGRKLILEIAPTSDNDFGRYNCTATNRI
GTRYQEYTLGQADVPSNPYGVRVLELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASET
WKIVRSHGVQTMVVLSNLEPNTTYEIKVAAVNGKGQGEYSKIEIFQTLPVREPSPPSIHG
QPESGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGSRDHIILEHLQWTMG
YEVQITAANRLGYSEPTLYEFSMPPKPNIITDTLFNGLGLGAVIGLGVAALLLILVVTDV
SCFFVRQCGLLMCITRRICGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERITS
HEDGSPVNEPNETTPLTEPEKLPLKEENGKEALNPETIEIKVANDIIQSKEDDSKA
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgagcctcctgcctctctacctgctcggattgctcctcggtagcgggcaagctttactt
caagtaacaatttcacttagcaaagttgagctcagtgtgggtgaatccaagttcttcaca
tgcacagccattggtgagcctgagagcatagattggtacaacccacaaggagagaagatc
gtttctagtcagagggtggttgttcagaaggaaggtgttcgctcacgccttaccatttat
aacgcaaacatagaagatgctggtatataccggtgccaagcagcagatgctaaaggacaa
actcaagaagctactgtagttttggagatttatcaaaagctcacttttcgggacatagta
tctccacaggagttcaggcagggggaagatgcagaagttgtttgccgtgttacgagctca
cctgctcccattgtcagctggttgtatcggaatgaggaagtcacaactattgctgacaat
cgatttgcagtattagcaaacaataatctccaaattcttaagatcaataaaagtgatgaa
ggagtttacagatgtgaaggaagagtggaggcaagaggagaaattgactttcgggacata
attgttattgtgaatgttccccctgcaatcattctgctacagaaatccttcaatgccacg
gcagatcgaggagaggcaataactttgttctgcagagccactggatcacctccacctgag
atcagttggtacaggaatggtaaacttgttgaagaaaatgaaaaatatgtcctgagagga
agtaatacacagctaacaataagagatataaaaaatattgatgcgggtccttatatctgt
aatgctaaaaacaaagcaggaaatgacaaacaacaaacagtccttcaagtttttgtgcag
cctcaaataatacaacttaaaaatgaaaccacatttgaaaatgggaaagcaactctcatc
tgtgaagcagaaggagaacctgtcccagagattacgtggaaaagggccattgatggaatg
actttctctgaaggtgacaagagcccagatggccgtatagaagtcaaagggcagcatgga
aagtcgtcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgtgaa
gctgcaagtagaattggtgggcaccaaaagagcatgtaccttgatattgaatatgctcca
acattcgtgtcaaatcaaaccatgtattactcttgggaaggcaatcccatcaatatcagc
tgtgaagtgctagcaaatccatctgcctcagttcagtggaaaagaggaaaattagtttta
cctgtaaaaaatacaactcatttgaagacctacagtacaggaagaaagcttattctagag
attgctcccacatctgacaatgattttggacggtacaattgtacagccacaaacagaata
ggaacaagataccaggagtatacacttggtcaagctgatgtgccatcaaatccgtatgga
gtacgagtcttagagctgtcacaaaccactgccaaggtttccttcaataagccagattca
catggaggtgtgcccatccaccactaccaagtggacgtgaaagaggtggcctcagaaacc
tggaaaatagttcgctcccatggagttcaaactatggttgttctaagcaatttggaacca
aatacaacttatgaaatcaaagtagctgctgtaaatggaaaagggcaaggagagtatagc
aaaattgagatctttcagaccttacctgtccgggagccaagtcccccttcaattcatgga
caaccagagagtggcaagagttttaaacttagtataactaaacaagatgatggaggtgcc
cccatactggaatatattgtcaaatacagaagtaaagataaggaagaccagtggctagag
aaaaaagtacagggtagtagagaccacatcatcttagagcatcttcaatggaccatggga
tatgaagtacaaattacagctgccaacagactgggttattctgaaccaacattgtatgaa
ttcagcatgccaccaaagcccaacattattacagacactctttttaatggtcttggactt
ggtgctgtcattggcctgggagtggcagcccttttgttaatcctggttgtgactgatgtt
agctgcttctttgtacgacaatgtggattgctcatgtgcatcaccaggagaatctgtggg
aagaagagtggttcaagtggaaaaagtaaagaactggaagaaggaaaagctgcttacttg
aaagatggatcaaaagagccaatagtggaaatgagaacagaggatgaaagaattaccagc
catgaagatgggagtccagtaaatgagccaaatgagacaactcctctcacagaaccagag
aagctgccactaaaggaggaaaatggcaaagaagctttaaatccagaaaccatagaaatc
aaagttgctaatgatatcatccagtcaaaagaagatgatagcaaagcataa

DBGET integrated database retrieval system