KEGG   Taeniopygia guttata (zebra finch): 100224441
Entry
100224441         CDS       T01082                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X2
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    100224441 (AHRR)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100224441 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_11
Other DBs
NCBI-GeneID: 100224441
NCBI-ProteinID: XP_002190162
Position
2
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQDGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVRAKHKADDAAAANTN
SSSKGSSGLSEATELYGRNNHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLTQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRTNPCPNRRAGSFYNRDQHFLNLASTCPSHWGNAENGQPYSGLQQRCAENYATD
HLKLQRPLISSESLYDTAVPLEMPIKTEYDSDSENVADNYLLSQGRAWLDESSSVRKQVS
SYPNRMHLKMEPDLCEPALPCQKARHCLYTPHNWQCIIANHPNNLNLNRACKGSRNKEVP
PFCPQNSSVCLESMPDLSHTACYSHFYSPSPGEEKEPINEVFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRVHTSFPENTLAGPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcgaagagacacagagaccgtctg
aacgcggaactggaccacctggccagcctccttccttttccacctgacatcgtatcaaag
ctggacaaactttctgtcttgcgccttagcgtcagctatctccgagtcaaaagtttcttt
caagctattcaagaaaagcactttaagaagcaagatggccaaacgataaaagaagacaat
atatctaacaagactgctgtacaagaaggtggactgctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gaccgccaggatttttgtagacaactgcactgggccatgaatcctccccagatgttgtca
ggacagcagctacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caagagaatgacagcatgacaacagattattcttcctttttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggatttcttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaaggaagaagtcctcatcaggaacagtactgccacctcag
ctgtctttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgagagcaaaacacaaagctgatgatgcagcagcagcgaacacaaac
tccagttcaaaaggcagttcaggactttctgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcactaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagttaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctctatcgaagtggttgttcagaatatgtcctt
acccaacagcaaatgttaaaggaagaagatgagcaactgaagatactaagtggttttgcc
agtttgaaaggaaacctggaggggctttcctataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttatgcaagaggaacctctgagttctaacacatca
gttttaggcatacaaaacaactgcaccacaaacagtagctggactttaagaaactccagt
tcttgttccatgagccagagaacgaacccatgcccaaacaggagagctggatcattctac
aacagagaccaacattttttaaatttggcatcaacttgtccttcccactgggggaatgca
gaaaatggccagccttactcggggctccaacagcgctgtgcagagaactatgccacagac
cacctgaagctgcagagaccattaatatcctcagagtctctctatgacacagccgttccc
ttggagatgcctatcaaaacggaatacgactctgattctgaaaacgttgctgataactac
ctgctttcgcagggccgagcctggctggatgagagcagctcagtgagaaagcaggtgtcc
agctatcccaatagaatgcacctcaaaatggagccggacctctgtgagccagccttgcca
tgccagaaggcaaggcactgcctttacacaccccataattggcaatgcatcatagcaaat
catcccaacaacctcaacttgaacagagcttgcaagggttcacggaacaaggaggtgccc
cccttttgccctcagaactcctctgtgtgtttggaaagcatgcctgacctatcacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagccaattaatgag
gtgttcaaaatgccatgtgaatttaaaaacccctgcttggttcaagcaatcaagcgtgag
cccctagattctccaccattgtccaacagtggacagaacagagtacacacaagcttccct
gaaaatacattagcaggtcctgtacctcataaaaccacagaatgtacatttttgcaatag

DBGET integrated database retrieval system