KEGG   Taeniopygia guttata (zebra finch): 100230662
Entry
100230662         CDS       T01082                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100230662 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    100230662 (MECOM)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100230662 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 Zn-ribbon_8 zf-met PyrI_C
Other DBs
NCBI-GeneID: 100230662
NCBI-ProteinID: XP_030135870
Ensembl: ENSTGUG00000011015
Position
9
AA seq 1246 aa
MRSKGRARKLAASDECLYESFPELPLGEVPEADGEAANVQCPTSISIQEPSSPATSSEAF
TPKESSPYKAPIYIPDDIPIPSEFELRESNIPGAGLGIWTKRKIEAGEKFGPFVGEQRPH
LKDPSYGWEILDEFCNVKFCIDASQPDVGNWLKYIKFAGCYNQHNLVACQISDQIFYRVV
ADIEPGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPH
SAFSMVEEDFQKKLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQC
PKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKT
FATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFST
TSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHP
AGLTFPTAPGFSFSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTNPQILP
ATQDILKALNKQPSVGENKPVELQPEGSSEERPHEKLSDQSESSDLDLDDVSTPSGSDLE
TTSGSDLESDIESEKEKFKENGKMFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAV
SGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRD
LRPLPLKVEPQSPSEIKKIPKGSSESPFDLTIKRKEEKPLTPIPSKPAAPSASSQDQPLD
LSMGSRSRASSTRQAEPRKNHVFGEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKR
KLTDPLEALKEKYLRPSPGFLFHPQFQFPDQRIWVSAIENMAEKLESFSALKPEASELIQ
SVPSMFNFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYC
DRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPH
SELESTGAILDDKEDSYFTEIRNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVASQNSD
LLDDEEAEDEVMMDEEDEESEMAGKAVKEPVPSDMHEGTPEEYYEETSTLDMNCKASPGR
YKEEEYNKTGLSALDHIRHFTDSLKMRKMEENQYSEAELAAFNASQLPEDLKQPLYRKSK
SQAYAMMLSLSDKDSLHSASHSSPNMWHSMARAAAESSAIQSISHV
NT seq 3741 nt   +upstreamnt  +downstreamnt
atgcgatccaagggcagggcgaggaagctggccgcaagtgatgaatgtttgtatgagagc
tttccagaacttcccttgggggaagtgccagaagctgatggagaggctgcaaatgtccag
tgtccaacatccatcagcatccaagagccgtcttctccagcgacctccagcgaagctttc
acacccaaggagagctctccttacaaggctccaatatacattcctgatgacattcccatt
ccttctgagtttgagctcagagaatccaacattcctggagcaggattagggatatggacc
aaaaggaagattgaagcaggggaaaaatttggcccttttgtaggagagcagcggccacac
ctgaaagatcctagttatggctgggagatcttggatgagttttgcaatgtgaagttctgc
atagatgccagtcaaccagatgtaggaaactggctcaaatatatcaagtttgctggatgc
tacaatcagcacaaccttgttgcatgtcaaataagtgatcagatattctacagagtggta
gcagatattgaaccaggagaggagctcttactgttcatgaagagtgaagattattcacat
gaaacaatggctccggacatccatgaggagcgccagtaccgctgcgaggactgtgaccag
ctcttcgagtccaaggctgagctggtggaccaccagaagtttccctgcagcacacctcac
tccgccttctccatggtggaggaggacttccagaagaagctggagaacgagaatgacctt
caggacgtgcatgagatccaggagtgtaaagagtgtgaccaggtcttcccagacttacaa
agcctggagaagcacatgctgtcacacagcgaggagagggagtacaagtgtgaccagtgc
cccaaagcttttaactggaagtccaacttgatacgtcaccaaatgtcacacgacagcggg
aagcactacgagtgtgagaactgtgccaaggttttcacggaccccagcaaccttcagagg
cacattcgttcccagcatgtgggggctcgtgctcacgcttgtccagagtgtggcaaaacc
tttgccacttcttcgggcctcaaacagcataaacacatccacagcagtgtcaaacctttt
atatgtgaggtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgc
atgcatgctgattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcact
acgtcttccttaaataaacacaggagattttgtgagggcaagaaccattttgcagcagga
ggattttttggccaaggcatttctcttcctggaaccccagctatggataaaacgtccatg
gttaatatgaatcatgcaaatccgggccttgctgactattttggagccaataggcatcct
gctggtcttacctttccaacagctcctggattttcttttagcttccccggtctgtttcct
tcaggcttgtaccacaggccacctttgctacctactagttctcctgttaaaggacttccg
agcgcagatcagacaaacaaaagccaaagtcccctcatgacaaatcctcagatactgcca
gccacccaggatattttgaaggcactaaataaacaaccatcagtaggggagaataagcca
gtggagcttcaaccagaagggtcctctgaagagaggccacatgagaaactcagtgaccag
tcagagagtagtgaccttgaccttgacgatgtcagtacccccagtggcagtgacctggaa
accacctcgggctctgatctggaaagtgacattgaaagtgagaaagagaaatttaaagaa
aatggtaaaatgttcaaagacaaagtaagctctctgcagagcctggcgtcaataaataat
aagaaagaccacagcaatcattccattttctcaccatccttagaggagcagactgcggtg
tcaggagcggtgaatgattctataaaggctattgcttctattgctgaaaagtactttggt
tcaacaggacttgtggggctgcaagacaaaaaagtcggagccttaccttacccttccatg
tttcccctcccgttttttccagcattctctcaatcaatgtatccatttcctgatagagac
ttgagaccgttacccttgaaagtggagccccaatcacccagtgaaattaagaagatccca
aagggaagctctgagtctccctttgacctcaccataaaacgtaaggaggagaagccactt
actcccatcccctcaaagccagcagccccctctgcatccagccaggaccagcctctggat
ctcagcatgggcagccgaagccgagccagcagcacgaggcaagctgagcctcggaaaaac
cacgtctttggagagaagaaaggaggagacctcgagcagaggaaagcttcagagtcctct
ttgcagcacgccaggcccaccccgttctttatggatcccatatacagagtagaaaaaaga
aagctaactgacccactggaagctttaaaagagaaatacttgagaccttccccgggattc
ttgtttcatccacaattccaatttcctgatcaaagaatttgggtgtcagctatcgagaac
atggctgagaagctggagagcttcagcgccctgaagccggaggccagcgagctgatccag
tcggtgccatccatgttcaacttccgcgcgccgcccagcgcgctccccgagacgctgctg
cgcaagggcaaggagcgctacacctgcagatactgtggcaagattttcccgagatctgca
aacctgacccgtcacctgaggacgcacactggagagcagccctatagatgcaaatactgt
gacagatcctttagcatatcctctaacctgcagagacatgtgcgtaacatccacaataaa
gagaagccattcaagtgtcacttgtgtgacaggtgttttggtcaacaaaccaatcttgac
agacatctaaaaaagcacgagaacgggaacatgtctggtactgcaacatcttcacctcac
tcagaactggaaagcacaggggcaatcctagatgacaaggaagactcttacttcacagaa
attaggaattttattggaaacagcaaccacaacaatcaatccccccgaaactcagaggag
agaatgaatggcagccactttaaggatgaaaaagccatggtagccagccagaactcggat
ctgctggatgatgaggaggcagaagatgaagtaatgatggatgaagaggatgaagagagc
gaaatggcagggaaggcagtcaaagagcccgtgccgagtgacatgcatgagggcactccc
gaggagtattatgaggaaacgagtactttggacatgaactgcaaagcttcccctggcagg
tataaagaagaggagtataataagactggactttcagctttggaccacataaggcacttc
acagatagcctaaaaatgaggaaaatggaagaaaatcaatacagtgaagctgaattggca
gctttcaatgcttcccagctgccagaggacctcaagcaaccgttgtacaggaaatccaaa
tcccaggcctatgccatgatgctctccctctccgacaaggactcccttcattctgcatcc
cacagttctcccaacatgtggcacagtatggcgagagccgccgcggaatccagcgccatc
cagtccatcagccacgtatga

DBGET integrated database retrieval system