KEGG   Thermotoga maritima MSB8: TM1565
Entry
TM1565            CDS       T00022                                 

Definition
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM1565
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM1565
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM1565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM1565
Enzymes [BR:tma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     TM1565
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM1565
  Eukaryotic Sec-SRP protein
   TM1565
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N AAA_22 CbiA AAA_17 Zeta_toxin CLP1_P AAA_30 AAA_33 ATP_bind_1 NTPase_1 MMR_HSR1 ResIII AAA_24 AAA_18 AAA Thymidylate_kin AAA_31 AAA_28 AAA_7 cobW APS_kinase 6PF2K G-alpha PP2C_C ABC_tran AAA_5 AAA_16 NACHT RNA_helicase DUF6263 KTI12 Arf
Other DBs
NCBI-ProteinID: AAD36632
UniProt: Q9X1Q1
Position
1554956..1556257
AA seq 433 aa
MFENLQEKLSRVFKNLSGRGKITEKNVKDAIREVKLSLLEADVNYKVVKEFVDHVLQKAL
GEEVLRSLTPDQQFIKIVRDELVRIMGEKNEPLRLVHRPAPIMMVGLQGSGKTTTCAKLA
KLLKKEGRNPLLVAADLYRPAAVDQLVKLGNQIGVNVVHDYNKTPVEIVKEAVDVAESTG
KDVLIVDTAGRLHIDEEMMKELEEIKKILNPDEILLVVDAMMGQDAVNTAKVFDERLDLT
GFVVTKMDGDARGGVILSIKYVTGKPVKFIGTSEKLDGLEPFHPDRIANRILGMGDVLSL
IEKVEKELDQEKMKKSAEKFLKAEFTLEDFKEQLQEMKKLGPLSSILEMLPGAPKVDVEM
SEKELKKIEAIINSMTIEERRNPGIINASRKRRIARGSGTTVQDVNKLLKSYEQMKALMK
RMKKGRFKIPFGF
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgttcgagaatcttcaggagaagctgtctagggttttcaagaatctgtctggacgcgga
aagatcacagaaaagaatgtaaaagacgcgatcagggaagtgaaactttccctgctcgaa
gctgatgtcaactacaaagttgtgaaagaattcgtggaccacgtcctccagaaagctctc
ggagaggaagtcctcaggagtctcacaccggaccagcagttcataaagatagtgagagac
gagcttgtaagaatcatgggagaaaagaacgaaccattgagactcgtccacagaccagct
cccataatgatggtgggacttcagggaagcggaaagaccacaacgtgtgcaaaactcgca
aagctcctcaaaaaagagggaaggaatcctttgcttgtcgcagcggatctgtaccgtcct
gcagccgttgatcagcttgtgaagcttggaaatcagattggtgtaaacgttgttcacgat
tacaacaaaacacccgttgagatagtgaaagaagctgtagacgttgctgagagtacagga
aaagatgttctgatagtggataccgctggtcgacttcacatagacgaagagatgatgaaa
gagctggaagagataaagaaaatcctgaacccagatgagatcctgctcgtcgttgacgcg
atgatggggcaggacgcagtcaataccgccaaggtgtttgatgaaaggctcgatttaaca
ggattcgttgtaacgaagatggacggagatgcaagaggcggagtcattctctccataaag
tacgtgactgggaaacccgttaaattcattggaacgagtgaaaaactcgatggtctggag
ccgttccatccagacagaatcgcaaaccgaatcctgggaatgggggacgttctttcactg
atcgaaaaagtggaaaaggaactcgatcaggaaaagatgaagaaaagcgcagaaaagttc
ctgaaggcagagttcaccctggaagatttcaaagaacagcttcaggagatgaaaaaactc
ggacctctttcttccattcttgagatgcttccaggtgcaccgaaggtcgatgtggagatg
agtgaaaaggagctgaaaaagatcgaggccatcataaattcgatgaccatagaagagaga
agaaatcccggtataataaacgccagtagaaaaaggagaatcgcacgtggaagtggaact
accgtccaggatgtgaacaaacttctcaaaagctatgaacagatgaaagctctaatgaag
aggatgaaaaaaggtagattcaaaataccatttggattctga

DBGET integrated database retrieval system