KEGG   Thermococcus sibiricus: TSIB_1041
Entry
TSIB_1041         CDS       T00928                                 

Definition
(GenBank) ATP-dependent RNA helicase, DEAD-family
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    TSIB_1041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tsi03019]
    TSIB_1041
   03009 Ribosome biogenesis [BR:tsi03009]
    TSIB_1041
Enzymes [BR:tsi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TSIB_1041
Messenger RNA biogenesis [BR:tsi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     TSIB_1041
Ribosome biogenesis [BR:tsi03009]
 Prokaryotic type
  rRNA helicases
   TSIB_1041
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 UTP25 ERCC3_RAD25_C
Other DBs
NCBI-ProteinID: ACS90097
UniProt: C6A3A2
Position
complement(946655..947803)
AA seq 382 aa
MSFEKLGLSENSLNAVRRKGFEKPTDIQKEVIPRLLRGDNDIIGQSQTGTGKTAAFALPL
IELIDEEIKEVQAIVITPTRELAIQVADEIRSLRGKRRINVLPVYGGQPIGPQIRNLRRG
VHIVVGTPGRVIDHIERGTLSLDGVSYFILDEADRMLDMGFIEDIERILRHTSEEKRVLM
FSATIPREILRLARRYLKDYEVIRIQDRSLAPELVEQIYFEVRPNKRFSLLCSILDEKDF
YGIVFCQTKRETRELASKLKTKGYSVEALNGDIPQKGRERILERFRKGKIRVLVATDVAA
RGIDVKDLTHVINYSIPQNPEAYVHRIGRTGREGKRGKAITFVAPWESPKLRDIERVARV
KIKEMAYPTEYGRRKRDIPMVS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagttttgaaaaattaggactttcagaaaacagtttaaatgctgtaagaagaaaaggg
tttgaaaaaccaactgatattcaaaaagaagttattcccaggcttttaagaggagataac
gatataatcggccaatctcaaactggaacaggcaaaactgcagcttttgcgcttccgtta
atagaacttatagatgaggaaataaaagaggttcaggcaatagtaataacacccactagg
gagcttgcaatccaggttgcggatgaaataaggtctttgagaggaaaaaggagaataaat
gttcttcccgtttatggaggtcaaccaatagggccccagatcagaaatttaagaagggga
gtgcatatagtagttggaactccgggaagagtaattgatcacatagagaggggcacactt
tcattggatggtgtgagctacttcatattggatgaagctgatagaatgctggatatgggt
tttatagaagacatcgaaagaattttgaggcacacaagcgaggaaaagagagttttgatg
ttttctgctacaattcctagagagatacttcggttggcgaggagatatttaaaggactat
gaagtgattagaatacaggataggagtcttgctccggagttggttgagcaaatttacttt
gaagtacgcccgaacaagaggttcagccttttatgcagtattttggatgaaaaagatttc
tatggaatagttttttgccagacgaaaagagaaacgagggagctagcatcgaaacttaag
actaaagggtacagtgtggaggctttgaatggtgacattccacaaaagggaagagaaagg
attttagagcgctttaggaagggcaaaattagagtcctagtggcaaccgacgttgcagct
aggggaatagacgtcaaggatctaacgcacgtgataaactattcaattccccaaaacccg
gaagcttacgttcacagaattggtagaactggaagagaaggcaagagagggaaggccata
acatttgtcgccccttgggaatctccgaaactaagagatatagaaagagtagctagagta
aaaataaaagaaatggcgtacccaacagagtatggaaggagaaaaagagacattccaatg
gtgtcttga

DBGET integrated database retrieval system