KEGG   Thermus thermophilus HB8: TTHA0651
Entry
TTHA0651          CDS       T00220                                 
Symbol
TTHA0651
Name
(GenBank) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: Apolipoprotein GvpL_GvpF DUF1664 Fzo_mitofusin Baculo_PEP_C Phage_Mu_Gam PspA_IM30 Trimer_CC SlyX
Other DBs
NCBI-ProteinID: BAD70474
UniProt: Q5SKJ2
Position
1:619859..620125
AA seq 88 aa
MPEDHLLERLEKLEGIVETTVRVLPPLVQDLSRRIDGLREEMQGVAARLEARIQQAEAKL
EGQIQWVRSELEGFTLIGVALAPLSLLR
NT seq 267 nt   +upstreamnt  +downstreamnt
gtgcccgaggaccacctgctggaacgcctggagaagctggaggggatcgtggagaccacg
gtgcgggtgctcccgcccttggttcaggacctctcccggcgcattgacgggctacgggag
gagatgcagggcgtggcggcccggctggaagcccgcatccaacaggcggaggccaagctg
gagggccagatccagtgggtccggtccgagctggagggcttcaccctcatcggggtggcc
ctggcccccctttccctgctgcgctaa

DBGET integrated database retrieval system